G2 Agent Template Details

Agent G2 - Active Directory Free System Page Table Entries DotNet v4

Description

Monitors Active Directory Free System Page Table Entries Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Active Directory Free System Page Table Entries DotNet v4	AD_Free_System_Page_Table_Entries	FreeSystemPageTableEntries	NULL	Free System Page Table Entries is the number of page table entries not currently in used by the system. This counter displays the last observed value only; it is not an average

Agent G2 - Active Directory Performance Counters DotNet v4

Description

Monitors AD Performance data

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Active Directory Performance Counters DotNet v4	DRAInboundObjectsPersec	DRAInboundObjectsPersec	NULL	The number of objects received (per second) through inbound replication from replication partners.
	DSServerBindsPersec	DSServerBindsPersec	NULL	Shows the number of DC-to-DC binds per second that are serviced by this DC.
	DRAInboundBytesTotalPersec	DRAInboundBytesTotalPersec	Bytes per second	It is the sum of the number of bytes (per second) of uncompressed data (never compressed) and compressed data (after compression) received through replication. Lack of activity indicates that the network is slowing down replication.
	DRAInboundObjectsAppliedPersec	DRAInboundObjectsAppliedPersec	NULL	This counter excludes changes that are received but not applied (for example, when the update is already made) and also how many replication updates are occurring on the server as a result of changes generated on other servers.
	ABClientSessions	ABClientSessions	NULL	AB Client Sessions is the number of connected Address Book client sessions.
	LDAPClientSessions	LDAPClientSessions	NULL	The number of sessions of connected LDAP clients. Lack of activity points to network problems.
	DSDirectoryReadsPersec	DSDirectoryReadsPersec	NULL	Shows the number of directory reads per second.
	DRAPendingReplicationSynchronizations	DRAPendingReplicationSynchronizations	NULL	The number of directory synchronizations that are queued for this server that are not yet processed. This counter helps in determining replication backlog - the larger the number, the larger the backlog. This value should be low, with a higher value indicating that the hardware is not adequately servicing replication.
	NTLMAuthentications	NTLMAuthentications	NULL	The number of NTLM authentications (per second) serviced by this domain controller
	DSDirectoryWritesPersec	DSDirectoryWritesPersec	NULL	Shows the number of directory writes per second.
	LDAPActiveThreads	LDAPActiveThreads	NULL	LDAP Active Threads is the current number of threads in use by the LDAP subsystem of the local direcotry service.
	KerberosAuthentications	KerberosAuthentications	NULL	The number of times per second that clients use a client ticket to this domain controller to authenticate to this domain controller. A lack of activity can indicate network problems that are preventing authentication requests from succeeding.
	DRAOutboundBytesTotalPersec	DRAOutboundBytesTotalPersec	Bytes per second	It is the sum of the number of bytes of uncompressed data (never compressed) and compressed data (after compression) sent per second. Lack of activity indicates that the hardware or network is slowing down replication.
	LDAPWritesPersec	LDAPWritesPersec	NULL	Shows the rate at which LDAP clients perform write operations.
	DSNotifyQueueSize	DSNotifyQueueSize	NULL	The number of pending update notifications that have been queued, but not yet transmitted to clients.
	DSClientBindsPersec	DSClientBindsPersec	NULL	Shows the number of Ntdsapi.dll binds per second serviced by this DC.
	LDAPUDPoperationsPersec	LDAPUDPoperationsPersec	NULL	Shows the number of UDP operations that the LDAP server is processing per second.
	LDAPBindTime	LDAPBindTime	Milliseconds	This counter shows the time required for completion of the last LDAP binding, with a higher value pointing to either hardware or network performance problems.
	LDAPSearchesPersec	LDAPSearchesPersec	NULL	The number of search operations per second performed by LDAP clients. A lack of activity points to network problems.
	DRAOutboundObjectsPersec	DRAOutboundObjectsPersec	NULL	The number of objects sent (per second) through outbound replication to replication partners.
	DRAInboundObjectUpdatesRemaininginPacket	DRAInboundObjectUpdatesRemaininginPacket	NULL	This counter tells you whether the monitored server is receiving changes, but is taking a long time applying them to the database. The value should be low, with a higher value indicating that the hardware is incapable of adequately servicing replication (warranting a server upgrade).

Agent G2 - AD Database Monitoring - v2

Description

Monitor AD database metrics like DBFileSizeGrowth, DBFile_DiskUsage, DiskHealthStatus, FreeDiskSpace.

Note: Previous version “Agent G2 - AD Database Monitoring” template has a bug at the monitor level. We recommend using the latest template (Agent G2 - AD Database Monitoring - v2)

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - AD Database Custom Monitor - v2	AD_Database_DBFileSizeGrowth	AD Database DBFile Size Growth	MB	It monitors the growth of the Active Directory database file size. It calculates the delta of the database file size from previous poll to current poll.
	AD_Database_FreeDiskSpace	AD Database FreeDiskSpace	MB	It monitors the free disk space in MB for the drives which are having Active Directory Database file / Log file.
	AD_Database_DiskHealthStatus	AD Database Disk Health Status	null	It monitors the disk health status of the drive which is having an Active Directory DB File. Below are the possible states: 0 - Healthy 1 - Warning 2 - Unhealthy 3 - Unknown
	AD_Database_DBFile_DiskUsage	AD Database DBFile DiskUsage	%	It monitors the disk usage% of the drive which is having Active Directory DB file.

Agent G2 - AD Performance Counters DotNet v4

Description

Agent G2 - AD Performance Counters DotNet v4

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - AD Performance Counters DotNet v4	directory.services.ldap.successful.binds.per.sec	Directory Services LDAPSuccessfulbindspersec	NULL	Number of LDAP Binds per second
	directory.services.dra.outbound.values.dns.only.per.sec	Directory Services DRAOutboundvaluesdnsonlypersec	NULL	Number of object property values containing Distinguished Names sent to outbound replication partners. DN-values, such as group or distribution list memberships, are generally more expensive to read than other kinds of values
	directory.services.dra.inbound.values.dns.only.per.sec	Directory Services DRAInboundvaluesdnsonlypersec	NULL	Number of object property values received from inbound replication partners that are Distinguished Names; i.e., that reference other objects. DN-values, such as group or distribution list memberships, are generally more expensive to apply than other kind
	directory.services.threads.in.use	Directory Services Threadsinuse	NULL	DS Threads in Use is the current number of threads in use by the directory service (different than the number of threads in the directory service process). Threads in Use is the number of threads currently servicing client API calls and can be used to in
	directory.services.dra.inbound.full.sync.objects.remaining	Directory Services DRAInboundfullsyncobjectsremaining	NULL	Number of objects remaining until the full sync completes (when set)

Agent G2 - Backup Symantec Exec-11-Performance Counters DotNet v4

Description

Template for Symantec backup exec. Monitors total bytes, total directories and total files. Also performs event log monitoring.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Backup Symantec Exec-11-Performance Counters DotNet v4	TotalDirectories	TotalDirectories	NULL	The total number of directories that have been backed up since the Backup Exec Engine Service last started.
	TotalFiles	TotalFiles	NULL	The total number of files that have been backed up since the Backup Exec Engine Service last started.
	TotalBytes	TotalBytes	NULL	The total number of bytes that have been backed up since the Backup Exec Engine Service last started.

Agent G2 - Backup-Symantec Exec-12.5-Performance Counters DotNet v4

Description

12.5_Symantec_Backup_Exec. Monitors total bytes, total directories and total files.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Backup-Symantec Exec-12.5-Performance Counters DotNet v4	TotalBytes	TotalBytes	NULL	The total number of bytes that have been backed up since the Backup Exec Engine Service last started.
	FailedJobs	FailedJobs	NULL	The number of jobs that have failed since the Backup Exec Engine Service last started.
	TotalDirectories	TotalDirectories	NULL	The total number of directories that have been backed up since the Backup Exec Engine Service last started.
	TotalFiles	TotalFiles	NULL	The total number of files that have been backed up since the Backup Exec Engine Service last started.

Agent G2 - Backup-Veritas-Job Performance Counters DotNet v4

Description

Monitors the AbortedJobs, ActiveJobCount, BackupDeviceWaitTime, InUseSkippedObjects MountTime, TotalExchangeMailboxes, TotalSQLServerDatabases.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Backup-Veritas-Job Performance Counters DotNet v4	BackupDeviceWaitTime	BackupDeviceWaitTime	Seconds	The total time (in seconds) all backup jobs have spent waiting for a storage device since the Backup Exec Engine Service last started.
	AbortedJobs	AbortedJobs	NULL	The number of jobs that have been aborted since the Backup Exec Engine Service last started.
	MountTime	MountTime	Seconds	The total time (in seconds) all jobs have spent waiting for media to be mounted in a storage device since the Backup Exec Engine Service last started.
	InUseSkippedObjects	InUseSkippedObjects	NULL	The number of objects that have been skipped because they were in use during backup since the Backup Exec Engine Service last started.
	FailedJobs	FailedJobs	NULL	The number of jobs that have failed since the Backup Exec Engine Service last started.
	ActiveJobCount	ActiveJobCount	NULL	The number of jobs currently active (running or pending) in the Backup Exec Engine Service.

Agent G2 - Blackberry 501 Performance Counters DotNet v4

Description

Monitor Blackberry 501 Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Blackberry 501 Performance Counters DotNet v4	MessagesQueuedForDelivery	MessagesQueuedForDelivery	NULL	Blackberry Agent displays queued messages for delivery
	MessagesExpired	MessagesExpired	NULL	Blackberry Agent displays expired messages
	MessagesSent	MessagesSent	NULL	Blackberry Agent displays sent messages
	MessagesReceived	MessagesReceived	NULL	Blackberry Agent displays received messages
	MessagesFiltered	MessagesFiltered	NULL	Blackberry Agent displays filtered messages

Agent G2 - Blackberry Enterprise Server

Description

Template for BlackBerry enterprise server. Monitors messages expired, messages filtered, messages queued for delivery, messages received and messages sent. Also performs event log monitoring.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Blackberry Enterprise Server	MessagesQueuedForDelivery	MessagesQueuedForDelivery	NULL	Blackberry Agent displays queued messages for delivery
	MessagesExpired	MessagesExpired	NULL	Blackberry Agent displays expired messages
	MessagesSent	MessagesSent	NULL	Blackberry Agent displays sent messages
	MessagesReceived	MessagesReceived	NULL	Blackberry Agent displays received messages
	MessagesFiltered	MessagesFiltered	NULL	Blackberry Agent displays filtered messages

Agent G2 - Blackberry Performance Counters DotNet v4

Description

Monitors Blackberry Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Blackberry Performance Counters DotNet v4	MessagesQueuedForDelivery	MessagesQueuedForDelivery	NULL	Blackberry Agent displays queued messages for delivery
	MessagesExpired	MessagesExpired	NULL	Blackberry Agent displays expired messages
	MessagesSent	MessagesSent	NULL	Blackberry Agent displays sent messages
	MessagesReceived	MessagesReceived	NULL	Blackberry Agent displays received messages
	MessagesFiltered	MessagesFiltered	NULL	Blackberry Agent displays filtered messages

Agent G2 - Cisco Unity Performance Counters DotNet v4

Description

Monitors Cisco Unity Performance data

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Cisco Unity Performance Counters DotNet v4	IncomingCallsExternalCurrent	IncomingCallsExternalCurrent	NULL	The current number of incoming calls from external callers.
	PortsIdleCurrent	PortsIdleCurrent	NULL	The current number of integration ports that are not in use by the Cisco Unity Connection server.
	TTSSessionsPersec	TTSSessionsPersec	NULL	The number of active TTS voice sessions per second.
	MessageStoresOfflineCurrent	MessageStoresOfflineCurrent	NULL	A current total of Cisco Unity Message Stores that are offline.
	PortsUsedCurrent	PortsUsedCurrent	NULL	The current number of integration ports that are in use by the Cisco Unity Connection server.
	AverageAuthenticationTime	AverageAuthenticationTime	NULL	Average time taken to authenticate.
	TTSSessionDurationAverage	TTSSessionDurationAverage	NULL	The average duration of all TTS sessions in seconds.
	MessageStoresOnlineCurrent	MessageStoresOnlineCurrent	NULL	A current total of Cisco Unity Message Stores that are online.
	PortsLockedCount	PortsLockedCount	NULL	The current count of the ports that no longer respond or are otherwise unusable by Cisco Unity Connection
	UnityMTAMessageCountCurrent	UnityMTAMessageCountCurrent	NULL	The number of messages currently queued in the MTA(Message Transfer Agent).
	IncomingCallsDurationAverage	IncomingCallsDurationAverage	NULL	The average duration in seconds of all incoming calls to the Cisco Unity Connection server.
	DirectoryResynchronizationDurationAverage	DirectoryResynchronizationDurationAverage	NULL	The average duration of information directory synchronization, in seconds
	PortsIdleDurationAverage	PortsIdleDurationAverage	NULL	The average time that any port remains idle between incoming calls to the Cisco Unity Connection server in seconds.
	OutgoingCallsDurationAverage	OutgoingCallsDurationAverage	NULL	The average duration of all outgoing calls from the Cisco Unity Connection server in seconds.

Agent G2 - Citrix Broker Agent DotNet v4

Description

Monitors Citrix Broker Agent role performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix Broker Agent DotNet v4	citrix.broker.agent.total.sessions	CitrixBrokerAgent TotalSessions	NULL	Total Number of Sessions
	citrix.broker.agent.num.of.registrations	CitrixBrokerAgent NumberofRegistrations	NULL	Total Number of Registrations
	citrix.broker.agent.total.app.sessions	CitrixBrokerAgent TotalAppSessions	NULL	Total Number of Seamless App Sessions
	citrix.broker.agent.total.notifications	CitrixBrokerAgent TotalNotifications	NULL	Total Number of Notifications
	citrix.broker.agent.num.of.deregistrations	CitrixBrokerAgent NumberofDeregistrations	NULL	Total Number of DeRegistrations
	citrix.broker.agent.total.desktops.session	CitrixBrokerAgent TotalDesktopsSession	NULL	Total Number of Desktop Sessions

Agent G2 - Citrix Broker Service DotNet v4

Description

Monitors Citrix Broker Service role performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix Broker Service DotNet v4	citrix.broker.service.hard.registrations.per.sec	CitrixBrokerService HardRegistrationsPerSec	NULL	Hard Registrations/sec is the rate at which virtual desktop agents hard-register with Citrix Broker Service

Agent G2 - Citrix Licensing

Description

Template for Citrix Licensing

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix Licensing	Total_License	Total_License	NULL	The sum of the total license count of the citrix concurrent licenses with the common name available in the citrix licensing server.
	License_Usage	License_Usage	NULL	The sum of the license usage number of the citrix concurrent licenses being used currently with the common name.
	License_Used_Percentage	License_Used_Percentage	NULL	License percent used is the percentage of the license usage of the citrix concurrent licenses with the common name in the citrix licensing server.
	License_SA_Expiry_in_days	License_SA_Expiry_in_days	NULL	Provides the number of days remaining to expire subscription advantage (SA) of all the possible licenses of the citrix license server.

Agent G2 - Citrix Licensing Performance Counters

Description

Monitors Citrix Licensing Performance data

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix Licensing Performance Counters	Total_License	Total_License	NULL	The sum of the total license count of the citrix concurrent licenses with the common name available in the citrix licensing server.
	License_Usage	License_Usage	NULL	The sum of the license usage number of the citrix concurrent licenses being used currently with the common name.
	License_Used_Percentage	License_Used_Percentage	NULL	License percent used is the percentage of the license usage of the citrix concurrent licenses with the common name in the citrix licensing server.
	License_SA_Expiry_in_days	License_SA_Expiry_in_days	NULL	Provides the number of days remaining to expire subscription advantage (SA) of all the possible licenses of the citrix license server.

Agent G2 - Citrix Performance Counters DotNet v4

Description

These performance counters should be used to monitor the key performance metrics of the Citrix infrastructure, application servers, and virtual desktops.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix Performance Counters DotNet v4	citrix.percent.processor.time	Citrix Percent Processor Time	%	Percent Processor Time is the percentage of elapsed time that the processor spends to execute a non-Idle thread. It is calculated by measuring the duration of the idle thread is active in the sample interval, and subtracting that time from interval duration. (Each processor has an idle thread that consumes cycles when no other threads are ready to run). This counter is the primary indicator of processor activity, and displays the average percentage of busy time observed during the sample interval. It is calculated by monitoring the time that the service is inactive and subtracting that value from 100 Percent
	citrix.logicaldisk.avg.disksecpertransfer	Citrix LogicalDisk Avg DiskSecPerTransfer	MS	The Average Disk Second counters show the average time in seconds of a transfer from or to a disk.
	citrix.logicaldisk.currentdiskqueuelength	Citrix LogicalDisk CurrentDiskQueueLength	NULL	Current disk queue length provides a primary measure of disk congestion. It is an indication of the number of transactions that are waiting to be processed.
	citrix.logicaldisk.avg.disksecperwrite	Citrix LogicalDisk Avg DiskSecPerWrite	MS	The Average Disk Second counters show the average time in seconds of a write from or to a disk.
	citrix.logicaldisk.percent.disktime	Citrix LogicalDisk Percent DiskTime	%	Percent Disk Time marks how busy the disk is.
	citrix.network.interface.bytestotalpersec	Citrix Network Interface BytesTotalPerSec	NULL	Bytes Total/sec shows the rate at which the network adaptor is processing data bytes. This counter includes all application and file data, in addition to protocol information, such as packet headers.
	citrix.system.processor.queuelength	Citirx System Processor Queue Length	NULL	Processor queue length is the number of threads in the processor queue. Unlike the disk counters, this counter shows ready threads only, not threads that are running. There is a single queue for processor time even on computers with multiple processors. Therefore, if a computer has multiple processors, you need to divide this value by the number of processors servicing the workload. A sustained processor queue of less than ten threads per processor is normally acceptable, dependent of the workload.
	citrix.paging.file.percentusage	Citrix Paging File Percent Usage	NULL	This is the percentage amount of the Page File instance in use.
	citrix.logicaldisk.percent.freespace	Citrix LogicalDisk Percent FreeSpace	%	Percent Free Space is the percentage of total usable space on the selected logical disk drive that is free.
	citrix.memory.available.bytes	Citrix Memory Available Bytes	%	Available memory indicates the amount of memory that is left after nonpaged pool allocations, paged pool allocations, process working sets, and the file system cache have all taken their piece.
	citrix.logicaldisk.avg.disksecperread	Citrix LogicalDisk Avg DiskSecPerRead	MS	The Average Disk Second counters show the average time in seconds of a read from or to a disk.

Agent G2 - Citrix XenApp 7.5 DotNet v4

Description

Monitor Citrix XenApp Server 7.5 version performance counters.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix XenApp 7.5 DotNet v4	Citrix_Conf_Logging_Database_State	Citrix_Conf_Logging_Database_State	NULL	Database Connected indicates whether this service is in contact with its database (1 is connected; 0 is not connected).

Agent G2 - Citrix XenApp 7.6 DotNet v4

Description

Monitor Citrix XenApp Server 7.6 version performance counters.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix XenApp 7.6 DotNet v4	citrix.conf.loggingdatabase.avgtransactiontime	Citirx Conf Logging Database Avg Transaction Time	NULL	The time on average, in seconds, taken to execute a database transaction. A baseline needs to be established in the environment in order to accurately establish threshold values.
	citrix.monitor.database.connected	Citrix Monitor Database Connected	NULL	Database Connected indicates whether this service is in contact with its database (1 is connected; 0 is not connected)
	citrix.conf.loggingdatabase.transactionerrorspersec	Citrix Conf Logging Database Transaction Errors Per sec	NULL	The rate at which database transactions are failing.
	citrix.env.test.database.connected	Citrix Env Test Database Connected	NULL	Database Connected indicates whether this service is in contact with its database (1 is connected; 0 is not connected)

Agent G2 - Citrix XenApp Advanced Performance Check

Description

XenApp Advanced Monitoring

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix XenApp Advanced Performance Check	XADisconnectedSessions	XADisconnectedSessions	Count	Lists sessions in disconnected state. This helps identify if there are any sporadic disconnects from the server.
	XAOfflineServers	XAOfflineServers	Count	A server can be taken offline either for maintenance or because the Server is unstable and is removed from available servers. These servers will not service any user requests.
	XAServerLoad	XAServerLoad	NULL	This monitor displays the load on each Citrix XenApp Servers. These load values can identify issues with your servers in addition to determining which server is the least/most loaded in your farm. A trending value of this monitor helps identify peak usage of the servers. A value greater than 9000 indicates a heavily loaded server
	XAServerApplication	XAServerApplication	Count	Number of applications hosted on each server. This help you decide if the load is distributed evenly across all your servers.
	XASessions	XASessions	Count	Number of active sessions per server.

Agent G2 - Citrix XenApp Performance Check DotNet v4

Description

XenApp Standard Monitoring

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix XenApp Performance Check DotNet v4	LicenseServerConnectionFailure	LicenseServerConnectionFailure	NULL	The number of minutes that the XenApp server has been disconnected from the License Server. The time returned should be less than 30 minutes. Ideally the returned time should be zero.
	WorkItemQueueExecutingCount	WorkItemQueueExecutingCount	NULL	The number of work items that are ready to be executed.
	DataStorewritesPersec	DataStorewritesPersec	NULL	The number of times data was written to the data store per second.
	ZoneElectionsTriggered	ZoneElectionsTriggered	NULL	The number of times a server triggers a zone election.
	STATicketTimeoutCount	STATicketTimeoutCount	NULL	The total number of ticket time-outs that occur during the lifetime of the STA.
	AverageLicenseCheckInResponseTimems	AverageLicenseCheckInResponseTimems	NULL	This component monitor returns the average response time for a license check-in operation in milliseconds.
	LatencySessionDeviation	LatencySessionDeviation	NULL	This component monitor returns the difference between the minimum and the maximum session latency values. This value should be as low as possible.
	BytesReceivedPersec	Bytes Received Per sec	NULL	This component monitor returns the data rate of incoming Independent Management Architecture(IMA) network traffic.
	NetworkConnections	NetworkConnections	NULL	This component monitor returns the number of active network IMA connections to IMA servers.
	LocalHostCachewritesPersec	LocalHostCachewritesPersec	NULL	The number of times data was written to the IMA local host cache per second.
	ResolutionWorkItemQueueExecutingCount	ResolutionWorkItemQueueExecutingCount	NULL	The number of work items that are currently being executed.
	WorkItemQueuePendingCount	WorkItemQueuePendingCount	NULL	The number of work items that are not yet ready to be executed.
	NumberofbusyXMLthreads	NumberofbusyXMLthreads	NULL	The number of busy threads.
	DataStorereadsPersec	DataStorereadsPersec	NULL	The number of times data was read from the data store per second.
	CPUEntitlement	CPUEntitlement	NULL	The percentage of CPU resource that Citrix CPU Utilization Management makes available to a user at a given time.
	CPUUsage	CPUUsage	NULL	The percentage of CPU resource consumed by a user at a given time averaged over a few seconds.
	STAPeakTicketRequestRate	STAPeakTicketRequestRate	NULL	The maximum rate of ticket generation requests per second during the lifetime of the STA.
	LongtermCPUUsage	LongtermCPUUsage	NULL	The percentage of CPU resource consumed by a user averaged over a longer period than the CPU Usage counter.
	ApplicationResolutionsPersec	ApplicationResolutionsPersec	NULL	The number of resolutions completed per second.
	DynamicStorewritesPersec	DynamicStorewritesPersec	NULL	The number of times data was written to the dynamic store per second.
	ApplicationEnumerationsPersec	ApplicationEnumerationsPersec	NULL	Enumeration is the process in which a client transmits data to locate servers on the network and retrieves information about the server farms published applications. During enumeration the XenApp Plug-in for Hosted Apps communicates with the Citrix XML Service or the ICA browser depending on the browsing protocol selected in the plug-in. This monitor provides the number of application enumerations per second.
	DataStoreConnectionFailure	DataStoreConnectionFailure	NULL	The number of minutes that the XenApp server has been disconnected from the data store. This value should be zero at all times.
	LastRecordedLicenseCheckOutResponseTimems	LastRecordedLicenseCheckOutResponseTimems	NULL	The last recorded license check-out response time in milliseconds.
	WorkItemQueueReadyCount	WorkItemQueueReadyCount	NULL	The number of work items that are not yet ready to be executed.
	STAPeakAllRequestRate	STAPeakAllRequestRate	NULL	Secure Ticket Authority (STA) is responsible for issuing session tickets in response to connection requests for published resources on XenApp. These session tickets form the basis of authentication and authorization for access to published resources.
	LatencySessionAverage	LatencySessionAverage	NULL	The average client latency over the lifetime of a session.
	LatencyLastRecorded	LatencyLastRecorded	NULL	This component monitor returns the last recorded latency value of the session.
	ICARoundtripLatencyMedian	ICARoundtripLatencyMedian	NULL	The median time of ICA roundtrip latency for all sessions on the server.
	BytesSentPersec	BytesSentPersec	NULL	This component monitor returns the data rate of outgoing IMA network traffic.
	STAPeakTicketRefreshRate	STAPeakTicketRefreshRate	NULL	The maximum rate of refresh requests per second during the lifetime of the STA.
	ResolutionWorkItemQueueReadyCount	ResolutionWorkItemQueueReadyCount	NULL	The number of work items that are ready to be executed.
	CPUReservation	CPUReservation	NULL	The percentage of total computer CPU resource reserved for a user, should that user require it.
	CPUShares	CPUShares	NULL	The proportion of CPU resource assigned to a user.
	LocalHostCachereadsPersec	LocalHostCachereadsPersec	NULL	The number of times data was read from the IMA local host cache per second.
	MaximumnumberofXMLthreads	MaximumnumberofXMLthreads	NULL	The maximum number of threads allocated to service Web-based sessions since the server restarted.
	AverageLicenseCheckOutResponseTimems	AverageLicenseCheckOutResponseTimems	NULL	This component monitor returns the average response time for a license check-out operation in milliseconds.
	ApplicationResolutionsFailedPersec	ApplicationResolutionsFailedPersec	NULL	The number of application resolutions failed per second.
	DynamicStorereadsPersec	DynamicStorereadsPersec	NULL	The number of times data was read from the dynamic store per second.
	STAPeakDataRequestRate	STAPeakDataRequestRate	NULL	The maximum rate of data requests per second during the lifetime of the STA.
	ZoneElectionsWon	ZoneElectionsWon	NULL	The number of times a server wins a zone election.
	ApplicationResolutionTimems	ApplicationResolutionTimems	ms	The time in milliseconds that a resolution took to complete. A baseline would be needed in order to establish increases during peak logon times before an accurate threshold can be defined.

Agent G2 - Citrix XenDesktop Advanced Performance Check

Description

Citrix XenDesktop advanced monitoring based on performance counters.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix XenDesktop Advanced Performance Check	DesktopsWithRegistrationStateAsAgentError	DesktopsWithRegistrationStateAsAgentError	NULL	Lists all Virtual Desktops which have not registered with the controller due to Agent Error. The state of being in communication is referred to as the VDA being registered with a controller. If communication fails for any reason the VDA is said to have failed to register with a controller and it will not be possible for DDC to broker a connection to the VDM in question; the VDM becomes a wasted resource.
	DesktopsUnRegistered	DesktopsUnRegistered	NULL	Lists all Virtual Desktops in the Unregistered state. The state of being in communication is referred to as the VDA being registered with a controller. If communication fails for any reason the VDA is said to have failed to register with a controller and it will not be possible for DDC to broker a connection to the VDM in question; the VDM becomes a wasted resource.
	DesktopsWithUnknownPowerState	DesktopsWithUnknownPowerState	NULL	The Virtual desktop power state and issuing of power commands to the VM depends on the DDC services being able to communicate with the hypervisor that hosts the VM. The unknown power state is a result of the DDC never having received a notification of the power state of the VM from the hypervisor (hence state unknown).
	DesktopsNeverRegistered	DesktopsNeverRegistered	NULL	Virtual desktop machine which never registered with the Desktop Controllers. An unregistered desktop cannot be used by an end-user.
	TotalDesktops	TotalDesktops	NULL	The total number of desktops in a given Desktop Group.
	BrokerHypervisorAlertSeverityRed	BrokerHypervisorAlertSeverityRed	NULL	Lists the current alerts objects reported by the hypervisors that the controller is monitoring.
	DesktopsFacingICALatency	DesktopsFacingICALatency	NULL	Desktop Receiver on the client PCs communicates with the Virtual Desktop Agent(VDA) on the Virtual Desktops using the ICA (Independent Computing Architecture). High latency on this communication channel would result in slowness/freezing of sessions.
	DesktopsDisconnected	DesktopsDisconnected	NULL	Number of Virtual Desktops whose summary state is in disconnected state.
	DesktopsFacingHighProfileLoadTime	DesktopsFacingHighProfileLoadTime	NULL	Desktop Receiver on the client PCs communicates with the Virtual Desktop Agent(VDA) on the Virtual Desktops using the ICA (Independent Computing Architecture). Profile Load time is directly impacted with the profile size. This results in users experiencing logon delays.
	DesktopsAvailable	DesktopsAvailable	NULL	The number of desktops available in a desktop group.
	DesktopGroupsUsage	DesktopGroupsUsage	NULL	% of virtual desktop machines used within a group.
	DesktopsInUse	DesktopsInUse	NULL	The number of desktops currently in use in a given Desktop Group.
	ActiveSessions	ActiveSessions	NULL	The number of Desktop sessions currently streamed.
	DesktopsinMaintenanceMode	DesktopsinMaintenanceMode	NULL	Putting a desktop in maintenance mode temporarily stops connections to the desktop so that maintenance tasks can be carried out. A user trying to connect to a desktop in maintenance mode will receive a message telling them the desktop is currently unavailable and to try reconnecting. XenDesktop has no control over desktops in maintenance mode. No user can log on to a desktop in this state. If a user is already logged on, maintenance mode takes effect as soon as they log off.
	DesktopsWithImageOutOfDate	DesktopsWithImageOutOfDate	NULL	Shows Desktop Groups that have desktops with Out Of Date Images

Agent G2 - Citrix XenDesktop Performance Counters

Description

Monitors the XenDesktop System, Power status, Available system count, Delivery Group Desktops available count, unregistered count along with the Controller details like State, Services 7 Licensing details etc., Applicable on the XenApp/Xendesktop 7.x versions.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix XenDesktop Performance Counters	broker.desktop.group.desktops.available	BrokerDesktopGroup DesktopsAvailable	%	Number of available desktops
	broker.desktop.group.desktops.disconnected	BrokerDesktopGroup DesktopsDisconnected	%	Number of disconnected desktops
	broker.catalog.available.count	BrokerCatalog AvailableCount	NULL	Number of available systems
	broker.desktop.group.desktops.unregistered	BrokerDesktopGroup DesktopsUnregistered	%	Number of unregistered desktops
	broker.desktop.group.desktops.never.registered	BrokerDesktopGroup Desktops NeverRegistered	%	Number of desktops never registered
	broker.desktop.group.desktops.preparing	BrokerDesktopGroup DesktopsPreparing	%	Number of desktops in preparing state

Agent G2 - Citrix XenDesktop Status and Performance Check DotNet v4

Description

Applicable on XenDesktop - Desktop Delivery Controller

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Citrix XenDesktop Status and Performance Check DotNet v4	RegistrationRequestsPersec	RegistrationRequestsPersec	NULL	Registration Requests/sec is the rate at which Citrix Broker Service receives registration requests from virtual desktops.
	RegistrationAvgRequestTime	RegistrationAvgRequestTime	NULL	Registration Avg. Request Time is the time on average in seconds taken to process a virtual desktop registration request in Citrix Broker Service. This delay is a one time daily expense
	BrokeredSessions	BrokeredSessions	NULL	Brokered Sessions is the number of virtual desktop sessions brokered by the Citrix Broker Service.

Agent G2 - CPU - Run Queue Monitor DotNet v4

Description

Number of threads in queue waiting for processor time. Threshold for this metric is based on the number of processors on the system. Ideal value range from one to three threads per processor.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - CPU - Run Queue Monitor DotNet v4	cpu.run.queue.monitor	CPU Run Queue Monitor	NULL	Number of threads in queue waiting for processor time. Threshold for this metric is based on the number of processors on the system. Ideal value range from one to three threads per processor.

Agent G2 - DB-Oracle DotNet v4

Description

Monitors Oracle Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - DB-Oracle DotNet v4	Oracle_UserRollbacks	Oracle User Rollbacks	Count	Validates the Number of User Roll backs.
	Oracle_DataFileDiskWrites	Oracle Data File Disk Writes	Count	Validates the Number of Data file disk writes to database.
	Oracle_CacheInvalidations	Oracle Cache Invalidations	Count	Validates the how many Cache invalidations on particular database.
	Oracle_TableSpaceFree	Oracle Table Space Free	MB	Validates free table space available
	Oracle_UsersCommit	Oracle Users Commit	Count	Validates Number of User commits
	Oracle_TableSpaceAllocated	Oracle Table Space Allocated	MB	Validates the Size allocated for the table by database.
	Oracle_Sessions	Oracle Sessions	Count	Validates how many sessions currently on particular database.
	Oracle_DataFileDiskReads	Oracle Data File Disk Reads	Count	Validates the Number of Data file disk reads by database.
	Oracle_LibraryCacheReloads	Oracle Library Cache Reloads	Count	Validates the Number of Library Cache Reloads by database.
	Oracle_DataFilelesizeAllocated	Oracle Data File size Allocated	MB	Validates the Data File Size Allocated for the database.
	Oracle_LibraryCacheGets	Oracle Library Cache Gets	Count	Validates the Number of Library Cache gets by database.
	Oracle_LongRunningQueries	Oracle Long Running Queries	Count	Validates the how many long running queries on particular database.
	Oracle_TablescanBlocks	Oracle Table scan Blocks	Count	Validates the Number of Table scan blocks by database.
	Oracle_BlockingLockQueries	Oracle Blocking Lock Queries	Count	Validates the how many block lock queries on particular database.
	oracle_processes	Oracle Processes	Count	Validates the how many processes on particular database.

Agent G2 - Dell Hardware Health - WMI DotNet v4

Description

Monitors the Dell hardware health parameters like CPU Status, Memory status, Fan status, Fan reading, Temperature status, Temperature reading, Power consumption watts sensor status, Power consumption watts sensor reading, Power consumption amps sensor status, Power consumption amps sensor reading, voltage status and voltage reading.

Prerequisites

Validated on Dell PowerEdge R710, Microsoft Windows Server 2008 R2 Standard Edition Service Pack 1, 64-bit.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Dell Hardware Health - WMI DotNet v4	dell.voltage.sensor.reading	Voltage Reading	NULL	Dell Voltage sensor current reading in millivolts.
	dell.temperature.reading	Temperature Reading	NULL	Dell Temperature sensor current reading in centigrade.
	dell.power.consumption.ampssensor.reading	Power Consumption Amps Sensor Reading	NULL	Dell Power consumption amps sensor current reading.

Agent G2 - DFS NameSpace Replication Performance Counters DotNet v4

Description

DFS Monitoring - Namespace and Replication Check

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - DFS NameSpace Replication Performance Counters DotNet v4	dfsnamespaceserviceapirequests.requestsprocessed	DFSNamespaceServiceAPIRequests RequestsProcessed	NULL	Requests Processed shows the number of requests to one API that were processed by the DFS Namespace service.
	dfsreplicatedfolders.deletedspaceinuse	DFSReplicatedFolders DeletedSpaceInUse	NULL	Deleted Space in Use shows the total size (in bytes) of the deleted files and folders currently in the Conflict and Deleted folder used by the DFS Replication service. The DFS Replication service detects remote deletes from its sending partner and moves the file or folder to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicatedfolders.deletedfilesgenerated	DFSReplicatedFolders DeletedFilesGenerated	NULL	Deleted Files Generated shows the number of replicated deleted files and folders that were moved to the Conflict and Deleted folder after they were deleted from a replicated folder on a sending member. The DFS Replication service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicationconnections.totalfilesreceived	DFSReplicationConnections TotalFilesReceived	NULL	Total Files Received shows the number of files that were received on the connection.
	dfsreplicatedfolders.conflictfoldercleanupscompleted	DFSReplicatedFolders ConflictFolderCleanupsCompleted	NULL	Conflict Folder Cleanups Completed shows the number of times conflict loser files and folders in the Conflict and Deleted folder were deleted by the DFS Replication service. The DFS Replication service automatically detects and resolves conflicts encountered in replicated folders and moves the losing version to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicationconnections.rdcbytesreceived	DFSReplicationConnections RDCBytesReceived	NULL	RDC Bytes Received shows the bytes that were received on this connection while replicating files using remote differential compression (RDC). This is the actual bytes received over the network without the networking protocol overhead.
	dfsreplicatedfolders.stagingspaceinuse	DFSReplicatedFolders StagingSpaceInUse	NULL	Staging Space In Use shows the total size (in bytes) of the files and folders currently in the staging folder used by the DFS Replication service. This counter will fluctuate as staging space is reclaimed. The DFS Replication service stages files and folders in the staging folder before they are replicated, and automatically cleans up the staging folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicationconnections.sizeoffilesreceived	DFSReplicationConnections SizeofFilesReceived	NULL	Size of Files Received shows the uncompressed size (in bytes) of the files received on this connection. This is the number of bytes that would have been received had DFS Replication compression not been used.
	dfsnamespaceservicereferrals.requestsprocessedpersec	DFSNamespaceServiceReferrals RequestsProcessedPersec	NULL	Requests Per Sec. shows the number of referral requests per second that were processed by the DFS Namespace service.
	dfsreplicationservicevolumes.usnjournalrecordsread	DFSReplicationServiceVolumes USNJournalRecordsRead	NULL	USN Journal Records Read shows the number of update sequence number (USN) journal records that were read by the DFS Replication service.
	dfsreplicatedfolders.deletedbytesgenerated	DFSReplicatedFolders DeletedBytesGenerated	NULL	Deleted Bytes Generated shows the total size (in bytes) of replicated deleted files and folders that were moved to the Conflict and Deleted folder after they were deleted from a replicated folder on a sending member. The DFS Replication service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicatedfolders.stagingfilescleanedup	DFSReplicatedFolders StagingFilesCleanedup	NULL	Staging Files Cleaned up shows the number of files and folders that were cleaned up from the staging folder by the DFS Replication service. The DFS Replication service stages files and folders in the staging folder before they are replicated, and automatically cleans up the staging folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicationconnections.rdcsizeoffilesreceived	DFSReplicationConnections RDCSizeofFilesReceived	NULL	RDC Size of Files Received shows the uncompressed size (in bytes) of files received with remote differential compression (RDC) for this connection. This is the number of bytes that would have been received had neither compression nor RDC been used. This is not the actual number of bytes received over the network.
	dfsreplicatedfolders.conflictspaceinuse	DFSReplicatedFolders ConflictSpaceInUse	NULL	Conflict Space in Use shows the total size (in bytes) of the conflict loser files and folders currently in the Conflict and Deleted folder used by the DFS Replication service. The DFS Replication service automatically detects and resolves conflicts encountered in replicated folders and moves the losing version to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicatedfolders.rdcbytesreceived	DFSReplicatedFolders RDCBytesReceived	NULL	RDC Bytes Received shows the number of bytes that were received in replicating files using remote differential compression (RDC) for this replicated folder. This is the actual bytes received over the network without the networking protocol overhead.
	dfsreplicationconnections.compressedsizeoffilesreceived	DFSReplicationConnections CompressedSizeofFilesReceived	NULL	Compressed Size of Files Received shows the compressed size of files (in bytes) received on the connection.
	dfsreplicatedfolders.conflictbytesgenerated	DFSReplicatedFolders ConflictBytesGenerated	NULL	Conflict Bytes Generated shows the total size (in bytes) of the files and folders in this replicated folder that were moved to the Conflict and Deleted folder by the DFS Replication service. The DFS Replication service automatically detects and resolves conflicts encountered in replicated folders and moves the losing version to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicatedfolders.rdcnumberoffilesreceived	DFSReplicatedFolders RDCNumberofFilesReceived	NULL	RDC Number of Files Received shows the number files that were received for this replicated folder.
	dfsreplicatedfolders.conflictfilescleanedup	DFSReplicatedFolders ConflictFilesCleanedup	NULL	Conflict Files Cleaned up shows the number the conflict loser files and folders that were deleted from the Conflict and Deleted folder by the DFS Replication service. The DFS Replication service automatically detects and resolves conflicts encountered in replicated folders and moves the losing version to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicatedfolders.fileinstallssucceeded	DFSReplicatedFolders FileInstallsSucceeded	NULL	File Installs Succeeded shows the number of files that were successfully received from sending members and installed locally on this server. The DFS Replication service replicates staged files into the staging folder, uncompresses them in the Installing folder, and renames them to the target location. The second and third steps of this process are known as installing the file.
	dfsreplicatedfolders.conflictbytescleanedup	DFSReplicatedFolders ConflictBytesCleanedup	NULL	Conflict Bytes Cleaned up shows the total size (in bytes) of the conflict loser files and folders that were deleted from the Conflict and Deleted folder by the DFS Replication service. The DFS Replication service automatically detects and resolves conflicts encountered in replicated folders and moves the losing version to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicatedfolders.stagingbytescleanedup	DFSReplicatedFolders StagingBytesCleanedup	NULL	Staging Bytes Cleaned up shows the total size (in bytes) of the files and folders that were cleaned up from the staging folder by the DFS Replication service. The DFS Replication service stages files and folders in the staging folder before they are replicated, and automatically cleans up the staging folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicationservicevolumes.databasecommits	DFSReplicationServiceVolumes DatabaseCommits	NULL	Database Commits shows the number of database commit operations performed by the DFS Replication service. This counter indicates how intensive the DFS Replication service is from a database perspective.
	dfsreplicatedfolders.fileinstallsretried	DFSReplicatedFolders FileInstallsRetried	NULL	File Installs Retried shows the number of file installs that are being retried due to sharing violations or other errors encountered when installing the files. The DFS Replication service replicates staged files into the staging folder, uncompresses them in the Installing folder, and renames them to the target location. The second and third steps of this process are known as installing the file.
	dfsreplicatedfolders.stagingfilesgenerated	DFSReplicatedFolders StagingFilesGenerated	NULL	Staging Files Generated shows the number of times replicated files and folders were staged by the DFS Replication service. The DFS Replication service stages files and folders in a staging folder before they are replicated, and automatically cleans up the staging folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicatedfolders.totalfilesreceived	DFSReplicatedFolders TotalFilesReceived	NULL	Total Files Received shows the number of files that were received by this replicated folder.
	dfsnamespaceservicereferrals.requestsprocessed	DFSNamespaceServiceReferrals RequestsProcessed	NULL	Requests Processed shows the number of referral requests that were processed by the DFS Namespace service.
	dfsreplicatedfolders.deletedbytescleanedup	DFSReplicatedFolders DeletedBytesCleanedup	NULL	Deleted Bytes Cleaned up shows the total size (in bytes) of replicating deleted files and folders (in bytes) that were cleaned up from the Conflict and Deleted folder by the DFS Replication service. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicatedfolders.rdccompressedsizeoffilesreceived	DFSReplicatedFolders RDCCompressedSizeofFilesReceived	NULL	RDC Compressed Size of Files Received shows the compressed size (in bytes) of the files received with remote differential compression (RDC) for this replicated folder. This is the number of bytes that would have been received had RDC not been used. This is not the actual bytes received over the network.
	dfsreplicationconnections.bytesreceivedpersecond	DFSReplicationConnections BytesReceivedPerSecond	NULL	Bytes Received Per Second shows an estimate of the average number of bytes that were received each second over the past 30 seconds.
	dfsreplicationservicevolumes.usnjournalunreadpercentage	DFSReplicationServiceVolumes USNJournalUnreadPercentage	NULL	USN Journal Unread Percentage shows the percent of the update sequence number (USN) journal that has not yet been read and processed by the DFS Replication service. A journal wrap will occur if this counter reaches 100.
	dfsreplicatedfolders.compressedsizeoffilesreceived	DFSReplicatedFolders CompressedSizeofFilesReceived	NULL	Compressed Size of Files Received shows the compressed size of files (in bytes) received for this replicated folder.
	dfsreplicatedfolders.deletedfilescleanedup	DFSReplicatedFolders DeletedFilesCleanedup	NULL	Deleted Files Cleaned up shows the number of replicated deleted files and folders that were cleaned up from the Conflict and Deleted folder by the DFS Replication service. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsnamespaceservicereferrals.requestsfailed	DFSNamespaceServiceReferrals RequestsFailed	NULL	Requests Failed shows the number of referral requests that were failed by the DFS Namespace service.
	dfsreplicatedfolders.updatesdropped	DFSReplicatedFolders UpdatesDropped	NULL	Updates Dropped shows the number of redundant file replication update records that were ignored by the DFS Replication service because they did not change the replicated file or folder. For example, dropped updates can occur when access control lists (ACLs) are overwritten with identical ACLs on a file or folder.
	dfsreplicationconnections.rdccompressedsizeoffilesreceived	DFSReplicationConnections RDCCompressedSizeofFilesReceived	NULL	Compressed Size of Files Received shows the compressed size (in bytes) of files received for this replicated folder.
	dfsnamespaceserviceapirequests.requestsfailed	DFSNamespaceServiceAPIRequests RequestsFailed	NULL	Requests Failed shows the number of requests to one API that were failed by the DFS Namespace service.
	dfsreplicatedfolders.bandwidthsavingsusingdfsreplication	DFSReplicatedFolders BandwidthSavingsUsingDFSReplication	NULL	Bandwidth Savings Using DFS Replication shows the percentage of bandwidth that was saved by the DFS Replication service for this replicated folder using a combination of remote differential compression (RDC) and other compression technologies that minimize network bandwidth. For example, a value of 20 indicates that the DFS Replication service used 20% less bandwidth than it would have used if it had transmitted the entire files uncompressed over the network.
	dfsnamespaceservicereferrals.avgresponsetime	DFSNamespaceServiceReferrals AvgResponseTime	NULL	Avg Response Time shows the average response time to the referral requests that were processed by the DFS Namespace service.
	dfsreplicationconnections.rdcnumberoffilesreceived	DFSReplicationConnections RDCNumberofFilesReceived	NULL	RDC Number of Files Received shows the number files that were received on this connection.
	dfsreplicationconnections.bandwidthsavingsusingdfsreplication	DFSReplicationServiceVolumes BandwidthSavingsUsingDFSReplication	NULL	Bandwidth Savings Using DFS Replication shows the percentage of bandwidth that was saved by the DFS Replication service for this connection using a combination of remote differential compression (RDC) and other compression technologies that minimize network bandwidth use. For example, a value of 20 indicates that the DFS Replication service used 20% less bandwidth than it would have used if it had transmitted the entire files uncompressed over the network.
	dfsnamespaceserviceapirequests.requestsprocessedpersec	DFSNamespaceServiceAPIRequests RequestsProcessedPersec	NULL	Requests Per Sec. Rate shows the number of API requests per second that were processed by the DFS Namespace service.
	dfsreplicationconnections.totalbytesreceived	DFSReplicationConnections TotalBytesReceived	NULL	Total Bytes Received shows the total number of bytes received on the connection. The bytes received value includes file data and replication metadata.
	dfsreplicatedfolders.conflictfilesgenerated	DFSReplicatedFolders ConflictFilesGenerated	NULL	Conflict Files Generated shows the number of files and folders in this replicated folder that were moved to the Conflict and Deleted folder by the DFS Replication service. The DFS Replication service automatically detects and resolves conflicts encountered in replicated folders and moves the losing version to the Conflict and Deleted folder. The service automatically cleans up the Conflict and Deleted folder when it exceeds a pre-configured threshold of the quota.
	dfsreplicationservicevolumes.usnjournalrecordsaccepted	DFSReplicationServiceVolumes USNJournalRecordsAccepted	NULL	USN Journal Records Accepted shows the number of update sequence number (USN) journal records that were processed by the DFS Replication service. The DFS Replication service processes all USN journal records for replicated content on a volume and ignores records for non-replicated files and folders on the volume.
	dfsnamespaceserviceapirequests.avgresponsetime	DFSNamespaceServiceAPIRequests AvgResponseTime	NULL	Avg Response Time shows the average response time to the requests to one API that were processed by the DFS Namespace service.
	dfsnamespace.foldercount	DFSNamespace FolderCount	NULL	Folder count shows the number of DFS folders or links in a namespace.
	dfsreplicatedfolders.sizeoffilesreceived	DFSReplicatedFolders SizeofFilesReceived	NULL	Size of Files Received shows the uncompressed size (in bytes) of the files received for this replicated folder. This is the number of bytes that would have been received had DFS Replication compression not been used.
	dfsreplicatedfolders.rdcsizeoffilesreceived	DFSReplicatedFolders RDCSizeofFilesReceived	NULL	RDC Size of Files Received shows the uncompressed size (in bytes) of the files received with remote differential compression (RDC) for this replicated folder. This is the number of bytes that would have been received had neither compression nor RDC been used. This is not the actual bytes received over the network.
	dfsreplicationservicevolumes.databaselookups	DFSReplicationServiceVolumes DatabaseLookups	NULL	Database Lookups shows the number of database search operations performed by the DFS Replication service This counter indicates how intensive the DFS Replication service is from a database perspective.
	dfsreplicatedfolders.stagingbytesgenerated	DFSReplicatedFolders StagingBytesGenerated	NULL	Staging Bytes Generated shows the total size (in bytes) of replicated files and folders in the staging folder created by the DFS Replication service since last restart and is monotonically increasing counter. The DFS Replication service stages files and folders in the staging folder before they are replicated, and automatically cleans up the staging folder when it exceeds a pre-configured threshold of the quota.

Agent G2 - Disk Performance Monitoring DotNet v4

Description

Disk Performance Monitoring

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Disk Performance Monitoring DotNet v4	AverageDiskWriteQueueLength	AverageDiskWriteQueueLength	NULL	Avg. Disk Write Queue Length is the average number of write requests that were queued for the selected disk during the sample interval.
	AvgDisksecPerRead	AvgDisksecPerRead	NULL	Avg. Disk sec/Read is the average time, in seconds, of a read of data from the disk.
	PercentDiskTime	PercentDiskTime	NULL	% Disk Time is the percentage of elapsed time that the selected disk drive was busy servicing read or write requests.
	AverageDiskReadQueueLength	AverageDiskReadQueueLength	NULL	Avg. Disk Read Queue Length is the average number of read requests that were queued for the selected disk during the sample interval.
	AvgDisksecPerWrite	AvgDisksecPerWrite	NULL	Avg. Disk sec/Write is the average time, in seconds, of a write of data to the disk.
	AvgDiskBytesPerTransfer	AvgDiskBytesPerTransfer	NULL	Avg. Disk Bytes/Transfer is the average number of bytes transferred to or from the disk during write or read operations. The disk is efficient if it transfers large amounts of data relatively quickly.
	AverageDiskQueueLength	AverageDiskQueueLength	NULL	Avg. Disk Queue Length is the average number of both read and write requests that were queued for the selected disk during the sample interval.

Agent G2 - DNS Performance Counters DotNet v4

Description

Monitors DNS performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - DNS Performance Counters DotNet v4	dns.dynamic.update.requests.received	DNS DynamicUpdateRequestsReceived	NULL	Dynamic Update Received is the total number of dynamic update requests received by the DNS server.
	dns.total.queries.received.per.sec	DNS TotalQueriesReceivedPerSec	NULL	Total Query Received/sec is the average number of queries received by DNS server in each second.
	dns.dynamic.update.requests.empty.persec	DNS DynamicUpdateRequestsEmptyPerSec	NULL	Dynamic Update NoOperation/sec is the average number of No-operation/Empty dynamic update requests received by the DNS server in each second.
	dns.nb.stat.memory.used	DNS NbStatMemoryUsed	NULL	Nbstat Memory is the total Nbstat memory used by DNS server.
	dns.udp.queries.received.per.sec	DNS UDPQueriesReceivedPerSec	NULL	UDP Query Received/sec is the average number of UDP queries received by DNS server in each second.
	dns.zone.transfers.success	DNS ZoneTransfersSuccess	NULL	Zone Transfer Success is the total number of successful zone transfers of the master DNS server.
	dns.tcp.queries.received.per.sec	DNS TCPQueriesReceivedPerSec	NULL	TCP Query Received/sec is the average number of TCP queries received by DNS server in each second.
	dns.caching.memory.used	DNS CachingMemoryUsed	NULL	Caching Memory is the total caching memory used by DNS server.
	dns.secure.updates.failed	DNS SecureUpdatesFailed	NULL	Secure Update Failure is the total number of secure updates failed of the DNS server.
	dns.tcp.message.memory.used	DNS TCPMessageMemoryUsed	NULL	TCP Message Memory is the total TCP message memory used by DNS server.
	dns.database.node.memory.used	DNS DatabaseNodeMemoryUsed	NULL	Database Node Memory is the total database node memory used by DNS server.
	dns.dynamic.update.requests.rejected	DNS DynamicUpdateRequestsRejected	NULL	Dynamic Update Rejected is the total number of dynamic updates rejected by the DNS server.
	dns.dynamic.updates.written.to.database	DNS DynamicUpdateswrittentodatabase	NULL	Dynamic Update Written to Database is the total number of dynamic updates written to the database by the DNS server.
	dns.secure.update.requests.received	DNS SecureUpdateRequestsReceived	NULL	Secure Update Received is the total number of secure update requests received by the DNS server.
	dns.udp.responses.sent.per.sec	DNS UDPResponsesSentPerSec	NULL	UDP Response Sent/sec is the average number of UDP reponses sent by DNS server in each second.
	dns.udp.message.memory.used	DNS UDPMessageMemoryUsed	NULL	UDP Message Memory is the total UDP message memory used by DNS server.
	dns.record.flow.memory.used	DNS RecordFlowMemoryUsed	NULL	Record Flow Memory is the total record flow memory used by DNS server.
	dns.tcp.responses.sent.per.sec	DNS TCPResponsesSentPerSec	NULL	TCP Response Sent/sec is the average number of TCP reponses sent by DNS server in each second.
	dns.zone.transfers.failed	DNS ZoneTransfersFailed	NULL	Zone Transfer Failure is the total number of failed zone transfers of the master DNS server.
	dns.total.responses.sent.per.sec	DNS TotalResponsesSentPerSec	NULL	Total Response Sent/sec is the average number of reponses sent by DNS server in each second.
	dns.dynamic.update.timeouts	DNS DynamicUpdateTimeouts	NULL	Dynamic Update TimeOuts is the total number of dynamic update timeouts of the DNS server.

Agent G2 - DNS Recursive Performance Counters DotNet v4

Description

Monitors DNS Recursive Class WMI Performance data

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - DNS Recursive Performance Counters DotNet v4	DNS_RecursiveTimeOutPerSec	DNS_RecursiveTimeOutPerSec	NULL	Provides the average number of recursive query sending timeouts in each second.
	DNS_RecursiveQueryFailurePerSec	DNS_RecursiveQueryFailurePerSec	NULL	Provides the average number of recursive query failures in each second.
	DNS_RecursiveQueriesPerSec	DNS_RecursiveQueriesPerSec	NULL	Provides the average number of recursive queries received by DNS server in each second.

Agent G2 - Fujitsu PRIMERGY Health - Windows

Description

Monitor the following metrics for Fujitsu PRIMERGY Health on Windows servers: fujitsu_primergy_host_raidController_healthState, fujitsu_primergy_host_raidController_primaryStatus, fujitsu_primergy_diskDrive_healthState, fujitsu_primergy_diskDrive_primaryStatus, fujitsu_primergy_temperature_healthState, fujitsu_primergy_temperature_currentState, fujitsu_primergy_temperature_currentReading, fujitsu_primergy_voltage_healthState, fujitsu_primergy_voltage_currentState, fujitsu_primergy_voltage_currentReading, fujitsu_primergy_powerSupply_healthState, fujitsu_primergy_powerConsumptionSensor_healthState, fujitsu_primergy_powerConsumptionSensor_currentState, fujitsu_primergy_fan_healthState, fujitsu_primergy_fan_sensor_healthState, fujitsu_primergy_fan_sensor_currentState, fujitsu_primergy_fan_sensor_currentReading, fujitsu_primergy_managementController_healthState, fujitsu_primergy_processor_healthState, fujitsu_primergy_memory_healthState, fujitsu_primergy_cache_memory_healthState, fujitsu_primergy_physical_memory_healthState

Note: This template will be applicable only for the Agent version 14.0.0 or later.

Prerequisites

This template will be applicable only for the Agent version 14.0.0 or later.

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - Mongos Monitors	mongos.chunks	Mongos Chunks	NULL	Total number of mongos chunks
	mongos.chunks.balance	Mongos Chunks Balance	NULL	Provides Mongos chunks balance between database and collections
	mongos.shards	Mongos Shards	NULL	Total number of mongos shards
	mongos.collections	Mongos Collections	NULL	Total number of mongos sharded collections

Agent G2 - Linux - MySQL Advanced Monitors

Description

It monitors the mysql.Innodb_log_waits, mysql.long_running_procs, and mysqlindex_usage metrics.

Prerequisites

Provide database names as input arguments separated by commas when applying the template at the device level.

Syntax: DBName1,DBName2

Parameters

Name	Description	Default value
MySQL DBname	Dbnames to collect the metric data	NA
MySQL IPAddress	IPAddress of the server where mysql is running	127.0.0.1
MySQL Password	Password of the given username	NA
MySQL Port	Port on which mysql is running	3306
MySQL Username	Username to connect to mysql	NA

Note: All field attributes are mandatory. Please use default values wherever applicable.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - MySQL Advanced Monitors	mysql.Innodb_log_waits	Mysql Innodb log waits	NULL	The number of times that the log buffer was too small, and a wait was required for it to be flushed before continuing.
	mysql.long_running_procs	Mysql long running process	NULL	Total running process longer than 1 minute in a specific db.
	mysqlindex_usage	Mysql Index Usage	NULL	The sum of index lengths for the tables within the specified database.

Agent G2 - Linux - MySQL Global Performance Statistics

Description

Monitoring template for MySQL application. Monitors command statistics, select statistics, slave status, threads, etc.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - MySQL Global Performance Statistics	mysql.traffic	MySQL-Traffic	NULL
	mysql.threads_connected	MySQL-ThreadsConnected	NULL	The number of currently open connections.
	mysql.command_statistics	MySQL-CommandStatistics	NULL
	mysql.select_statistics	MySQL-SelectStatistics	NULL
	mysql.slave_status	MySQL-SlaveStatus	NULL	If a database has replication configured, then this monitor checks the status of the slave instance which is returned by the command SHOW SLAVE STATUS. It also checks the number of seconds the slave is behind the master and if IO and SQL is running on the slave
	mysql.threads	MySQL-Threads	NULL	Cached threads - The number of threads in the thread cache. Connected threads - The number of currently open connections. Running threads- The number of threads that are not sleeping.

Agent G2 - Linux - MySQL InnoDB Statistics

Description

Monitoring template for MySQL InnoDB application statistics. Monitors InnoDB buffer pool hit rate, buffer pool pages data, buffer pool pages dirty, etc.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - MySQL InnoDB Statistics	mysql.inno.db_buffer_pool_pages_free	MySQL-InnoDBBufferPoolPagesFree	NULL	The number of free pages.
	mysql.inno.db_data_read	MySQL-InnoDBDataRead	NULL	The amount of data read since the server was started.
	mysql.inno.db_buffer_pool_pages_flushed	MySQL-InnoDBBufferPoolPagesFlushed	NULL	The number of buffer pool page-flush requests.
	mysql.inno.db_log_flushed_upto	MySQL-InnoDBLogFlushedUpto	NULL	Log flushed up to.
	mysql.mutex_spin_waits	MySQL-MutexSpinWaits	NULL	Semaphores-Mutex Spin Waits.
	mysql.inno.db_data_writes	MySQL-InnoDBDataWrites	NULL	The total number of data writes.
	mysql.inno.db_buffer_pool_hit_rate	MySQL-InnoDBBufferPoolHitRate	NULL	Buffer Pool hit rate.
	mysql.inno.db_data_written	MySQL-InnoDBDataWritten	NULL	The amount of data written so far, in bytes.
	mysql.inno.db_row_lock_time	MySQL-InnoDBRowLockTime	NULL	The total time spent in acquiring row locks, in milliseconds.
	mysql.log_sequence_number	MySQL-LogSequenceNumber	NULL	Log Sequence number.
	mysql.queries_inside_innodb_core	MySQL-QueriesInsideInnoDBCore	NULL	Row Operations - Queries inside InnoDB core.
	mysql.inno.dbio_capacity	MySQL-InnoDBIOCapacity	NULL
	mysql.inno.db_transaction_history_length	MySQL-InnoDBTransactionHistoryLength	NULL
	mysql.inno.db_flush_log_at_trx_commit	MySQL-InnoDBFlushLogAtTRXCommit	NULL
	mysql.inno.db_buffer_pool_pages_misc	MySQL-InnoDBBufferPoolPagesMisc	NULL	The number of pages that are busy because they have been allocated for administrative overhead such as row locks or the adaptive hash index.
	mysql.inno.db_queries_queue	MySQL-InnoDBQueriesQueue	NULL	Row Operations - Queries in queue.
	mysql.inno.db_row_lock_waits	MySQL-InnoDBRowLockWaits	NULL	The number of times a row lock had to be waited for.
	mysql.inno.db_data_reads	MySQL-InnoDBDataReads	NULL	The total number of data reads.
	mysql.open_read_views_inside_innodb_core	MySQL-OpenReadViewsInsideInnoDBCore	NULL	Row Operations - Read views open inside InnoDB.
	mysql.mutex_spin_rounds	MySQL-MutexSpinRounds	NULL	Semaphores-Mutex Spin Rounds.
	mysql.inno.db_buffer_pool_pages_data	MySQL-InnoDBBufferPoolPagesData	NULL	The number of pages containing data (dirty or clean).
	mysql.inno.db_buffer_pool_pages_dirty	MySQL-InnoDBBufferPoolPagesDirty	NULL	The number of pages currently dirty.
	mysql.inno.db_log_last_check_point	MySQL-InnoDBLogLastCheckPoint	NULL	Log Last check point.
	mysql.inno.db_buffer_pool_read_requests	MySQL-InnoDBBufferPoolReadRequests	NULL	The number of logical read requests InnoDB has done.
	mysql.inno.db_non_hash_searches	MySQL-InnoDBNonHashSearches	NULL	Non-Hash Searches.
	mysql.inno.db_hash_searches	MySQL-InnoDBHashSearches	NULL	Hash Searches.
	mysql.inno.db_force_recovery	MySQL-InnoDBForceRecovery	NULL	Crash recovery mode, the possible values are 0-6: Normal Startup(0), Server Starts even if it detects a corrupt page(1), Prevent Master Thread from running(2), No Transaction Rollbacks after crash recovery(3), Prevent insert buffer merge Operations(4), Ignores undo logs-InnoDB treats incomplete Transactions as Committed(5), Ignores Redo log roll-forward in connection with recovery.(6).
	mysql.inno.db_buffer_pool_size	MySQL-InnoDBBufferPoolSize	NULL	The size in bytes of the memory buffer InnoDB uses to cache data and indexes of its tables. The default value is 8MB. The larger you set this value, the less disk I/O is needed to access data in tables.
	mysql.inno.db_data_fsyncs	MySQL-InnoDBDataFSyncs	NULL	The number of fsync operations so far.
	mysql.inno.db_buffer_pool_reads	MySQL-InnoDBBufferPoolReads	NULL	The number of logical reads that InnoDB could not satisfy from the buffer pool, and had to read directly from the disk.
	mysql.inno.db_log_file_size	MySQL-InnoDBLogFileSize	NULL	The size in bytes of each log file in a log group. The combined size of log files must be less than 4GB. The default value is 5MB. Sensible values range from 1MB to 1/N-th of the size of the buffer pool, where N is the number of log files in the group.
	mysql.mutex_os_waits	MySQL-MutexOSWaits	NULL	Semaphores-Mutex OS Waits.
	mysql.inno.db_buffer_pool_pages_total	MySQL-InnoDBBufferPoolPagesTotal	NULL	The total size of the buffer pool, in pages.
	mysql.inno.db_log_buffer_size	MySQL-InnoDBLogBufferSize	NULL	The size in bytes of the buffer that InnoDB uses to write to the log files on disk. The default value is 1MB for the built-in InnoDB, 8MB for InnoDB Plugin. Sensible values range.

Agent G2 - Linux - MySQL Monitors

Description

Monitoring template for MySQL application. Monitors command statistics, select statistics, slave status, threads, etc.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - MySQL Monitors	mysql.traffic	MySQL-Traffic	NULL
	mysql.threads_connected	MySQL-ThreadsConnected	NULL	The number of currently open connections.
	mysql.command_statistics	MySQL-CommandStatistics	NULL
	mysql.select_statistics	MySQL-SelectStatistics	NULL
	mysql.slave_status	MySQL-SlaveStatus	NULL	If a database has replication configured, then this monitor checks the status of the slave instance which is returned by the command SHOW SLAVE STATUS. It also checks the number of seconds the slave is behind the master and if IO and SQL is running on the slave
	mysql.threads	MySQL-Threads	NULL	Cached threads - The number of threads in the thread cache. Connected threads - The number of currently open connections. Running threads- The number of threads that are not sleeping.

Agent G2 - Linux - MySQL Variable Statistics

Description

Monitoring template for MySQL application statistics. Monitors aborted clients, aborted connects, command statistics, foreign key checks, log warnings, etc.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - MySQL Variable Statistics	mysql.threads_created	MySQL-ThreadsCreated	NULL	The number of threads created to handle connections.
	mysql.query_cache_free_memory	MySQL-QueryCacheFreeMemory	NULL	The amount of free memory for the query cache.
	mysql.max_heap_table_size	MySQL-MaxHeapTableSize	NULL	This variable sets the maximum size to which user-created MEMORY tables are permitted to grow. The value of the variable is used to calculate MEMORY table MAX_ROWS values.
	mysql.threads_cached	MySQL-ThreadsCached	NULL	The number of threads in the thread cache.
	mysql.traffic	MySQL-Traffic	NULL
	mysql.long_query_time	MySQL-LongQueryTime	NULL	If a query takes longer than this many seconds, the server increments the Slow_queries status variable.
	mysql.tmp_table_size	MySQL-TMPTableSize	NULL	The maximum size of internal in-memory temporary tables. If an in-memory temporary table exceeds the limit, MySQL automatically converts it to an on-disk MyISAM table.
	mysql.queries	MySQL-Queries	NULL
	mysql.aborted_connects	MySQL-AbortedConnects	NULL	The number of failed attempts to connect to the MySQL server.
	mysql.query_cache_size	MySQL-QueryCacheSize	NULL	Max amount of data that can be stored in the cache.
	mysql.select_statistics	MySQL-SelectStatistics	NULL
	mysql.threads_running	MySQL-ThreadsRunning	NULL	The number of threads that are not sleeping.
	mysql.query_cache_total_blocks	MySQL-QueryCacheTotalBlocks	NULL	The total number of blocks in the query cache.
	mysql.query_cache_free_blocks	MySQL-QueryCacheFreeBlocks	NULL	The number of free memory blocks in the query cache.
	mysql.max_used_connections	MySQL-MaxUsedConnections	NULL	Max number of connections that have been in use simultaneously since the server started.
	mysql.query_cache_low_memory_purnes	MySQL-QueryCacheLowMemoryPurnes	NULL	The number of queries that were deleted from the query cache because of low memory.
	mysql.slave_status	MySQL-SlaveStatus	NULL	If a database has replication configured, then this monitor checks the status of the slave instance which is returned by the command SHOW SLAVE STATUS. It also checks the number of seconds the slave is behind the master and if IO and SQL is running on the slave.
	mysql.thread_cache_size	MySQL-ThreadCacheSize	NULL	How many threads the server should cache for reuse. When a client disconnects, the client's threads are put in the cache if there are fewer than this monitor value.
	mysql.query_cache_not_cached	MySQL-QueryCacheNotCached	NULL	The number of noncached queries.
	mysql.query_cache_inserts	MySQL-QueryCacheInserts	NULL	The number of queries added to the query cache.
	mysql.table_definition_cache	MySQL-TableDefinitionCache	NULL	The number of table definitions (from .frm files) that can be stored in the definition cache.
	mysql.log_warnings	MySQL-LogWarnings	NULL	Whether to produce additional warning messages. It is enabled (1) by default and can be disabled by setting it to 0.
	mysql.aborted_clients	MySQL-AbortedClients	NULL	The number of connections that were aborted because the client died without closing the connection properly.
	mysql.query_cache_queries_in_cache	MySQL-QueryCacheQueriesInCache	NULL	The number of queries registered in the query cache.
	mysql.threads_connected	MySQL-ThreadsConnected	NULL	The number of currently open connections.
	mysql.foreign_key_checks	MySQL-ForeignKeyChecks	NULL	By default foreign key constraints for InnoDB tables are checked and the value will be 1. If set to 0, they are ignored. Disabling foreign key checking can be useful for reloading InnoDB tables in an order different from that required by their parent/child relationships.
	mysql.query_cache_hits	MySQL-QueryCacheHits	NULL	The number of query cache hits.
	mysql.open_table_cache	MySQL-OpenTableCache	NULL	The number of open tables for all threads.
	mysql.max_user_connections	MySQL-MaxUserConnections	NULL	Max number of simultaneous connections permitted to any given MySQL user. Default value is 0 (no limit).
	mysql.command_statistics	MySQL-CommandStatistics	NULL
	mysql.thread_stack_size	MySQL-ThreadStackSize	NULL	The stack size for each thread. Many of the limits detected by the crash-me test are dependent on this value.

Agent G2 - Linux - NFS Stats Monitors

Description

Agent G2 - Linux - NFS Stats Monitors

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - NFS Stats Monitors	nfs.lookup.ops	NFS Lookup Operations	NULL	The number of lookup operations per second issued to the filesystem.
	nfs.lookup.exe	NFS Lookup Op Request Execution Time	NULL	The duration from the time that NFS client does the RPC lookup request to its kernel until the RPC request is completed, this includes the RTT time above.
	nfs.server.write.mbytes	NFS Server Written Data	NULL	The number megabytes written to the NFS server by the NFS client via an NFS WRITE request.
	nfs.read.retransmissions	NFS Read Retransmissions	NULL	The number of retransmissions.
	nfs.write.rtt	NFS Write Op Request RTT Time	NULL	The duration from the time that client kernel sends the RPC write request until the time it receives the reply.
	nfs.read.ops	NFS Read Operations	NULL	The number of read operations per second issued to the filesystem.
	nfs.lookup.retransmissions	NFS Lookup Retransmissions	NULL	The number of retransmissions.
	nfs.lookup.kbytes	NFS Lookup Op Data	NULL	The amount of lookup data, in kB, per second.
	nfs.write.ops	NFS Write Operations	NULL	The number of write operations per second issued to the filesystem.
	nfs.directory.lookups	NFS Directory Lookups	NULL	The number of name lookups in directories there have been.
	nfs.write.kbytes	NFS Write Op Data	NULL	The amount of data, in kB, written per second.
	nfs.app.write.mbytes	NFS Application Written Data	NULL	The number of megabytes written by applications using the NFS mounted filesystem with the write(2) system call.
	nfs.app.write.direct.mbytes	NFS Application Written (O_DIRECT) Data	NULL	The number of megabytes written to files opened with the O_DIRECT flag.
	nfs.backlog	NFS Backlog	NULL	The length of the backlog queue.
	nfs.read.kbytes	NFS Read Op Data	NULL	The amount of data, in kB, read per second.
	nfs.server.read.mbytes	NFS Server Read Data	NULL	The number megabytes read from the NFS server by the NFS client via an NFS READ request.
	nfs.lookup.rtt	NFS Lookup Op Request RTT Time	NULL	The duration from the time that client kernel sends the RPC lookup request until the time it receives the reply.
	nfs.open.operations	NFS Open Operations	NULL	The number of times files or directories have been opened.
	nfs.write.size	NFS Write Op Data Size	NULL	The average number of kB written per each operation.
	nfs.write.exe	NFS Write Op Request Execution Time	NULL	The duration from the time that NFS client does the RPC write request to its kernel until the RPC request is completed, this includes the RTT time above.
	nfs.read.size	NFS Read Op Data Size	NULL	The average number of kB read per each operation.
	nfs.app.read.mbytes	NFS Application Read Data	NULL	The number of megabytes read by applications using the NFS mounted filesystem with the read(2) system call.
	nfs.ops	NFS Operations	NULL	The number of operations per second issued to the filesystem.
	nfs.age	NFS Mount Age	NULL	The duration of time that the share was mounted in minutes.
	nfs.lookup.size	NFS Lookup Op Data Size	NULL	The average amount of data size in kB for each lookup operation.
	nfs.rpc.badxids	NFS RPC Bad XIDs	NULL	The number of unmatchable XIDs that have been received.
	nfs.read.rtt	NFS Read Op Request RTT Time	NULL	The duration from the time that client kernel sends the RPC read request until the time it receives the reply.
	nfs.app.read.direct.mbytes	NFS Application Read(O_DIRECT) Data	NULL	The number of megabytes read from files opened with the O_DIRECT flag.
	nfs.read.exe	NFS Read Op Request Execution Time	NULL	The duration from the time that NFS client does the RPC read request to its kernel until the RPC request is completed, this includes the RTT time above.
	nfs.write.retransmissions	NFS Write Retransmissions	NULL	The number of retransmissions.

Agent G2 - Linux Network Interface

Description

Monitors the performance and status of network interfaces on Linux systems. It captures and analyzes ten essential metrics, including traffic, packet rates, errors, discards, operational states, and output queue lengths.

Prerequisites

Supported Metrics

Metric Name	Metric Display Name	Metric Description	Unit
Agent G2 - Linux Network Interface	system_linux_network_interface_trafficIn	System Linux Network Interface TrafficIn	Monitors the incoming network traffic on a Linux network interface. It indicates the amount of data received by the interface.	Kbps
	system_linux_network_interface_trafficOut	System Linux Network Interface TrafficOut	Monitors the outgoing network traffic on a Linux network interface. It indicates the amount of data transmitted by the interface.	Kbps
	system_linux_network_interface_packetsIn	System Linux Network Interface PacketsIn	Monitors the incoming network packets (number of packets) on a Linux network interface. It counts the number of packets received by the interface.	packets/sec
	system_linux_network_interface_packetsOut	System Linux Network Interface PacketsOut	Monitors the outgoing network packets (number of packets) on a Linux network interface. It counts the number of packets transmitted by the interface.	packets/sec
	system_linux_network_interface_errorsIn	System Linux Network Interface ErrorsIn	Monitors the incoming network errors (number of errors) on a Linux network interface. It counts the number of errors encountered while receiving data.	Errors per Sec
	system_linux_network_interface_errorsOut	System Linux Network Interface ErrorsOut	Monitors the outgoing network errors (number of errors) on a Linux network interface. It counts the number of errors encountered while transmitting data.	Errors per Sec
	system_linux_network_interface_discardsIn	System Linux Network Interface DiscardsIn	Monitors the incoming discarded network packets (number of discarded packets) on a Linux network interface. It counts the number of packets that were discarded upon receipt.	psec
	system_linux_network_interface_discardsOut	System Linux Network Interface DiscardsOut	Monitors the outgoing discarded network packets (number of discarded packets) on a Linux network interface. It counts the number of packets that were discarded upon transmission.	psec
	system_linux_network_interface_operationalState	System Linux Network Interface OperationalState	Monitors operational state of a Linux network interface. It typically provides information such as whether the interface is up or down.	NA
	system_linux_network_interface_outputQueueLength	System Linux Network Interface OutputQueueLength	Monitors the length of the output queue on a Linux network interface. It indicates the number of packets queued up for transmission.	count

Agent G2 - Linux NFS Mount Point Monitoring - v5

Description

Monitors the Linux NFS mount points availability, accessibility, and utilization. In Version 5 of the template, we introduced enhanced functionality to exclude specific users given in input while checking mount point writability. Additionally, users now have the flexibility to choose between monitoring all mounts or exclusively focusing on permanent mount points(i.e. only nfs mounts present in /etc/fstab).Pre-Requisites: NFS needs to be installed and 1 or more NFS Mount points should be available on target device. Agent must be installed as root.

Template Usage Guidelines

While applying this template on the device, users need to provide specific input parameters in below two formats only(Case-Insensitive) -

Format 1: MountType:All;ExcludedUsers:nobody,nfsnobody,anon
(This format monitors both temporary and permanent mount points, this is the default value)

Format 2: MountType:Permanent;ExcludedUsers:nobody,nfsnobody,anon
(This format monitors only Permanent Mounts which are available in \etc\fstab file)

Prerequisites

NFS needs to be installed and NFS Mount points should be available on target device. Agent must be installed as root.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux NFS Mount Point Custom Monitor - v5	system_linux_nfs_mountpoint_utilization	System Linux NFS Mountpoint Utilization	Percentage	Monitors the NFS Mount points utilization.
	system_linux_nfs_mountpoint_accessibility	System Linux NFS Mountpoint Accessibility	-	Monitors the accessibility of NFS Mount points. An accessible NFS mount point typically means both read and write access(marked as "0" in output), and inaccessibility (marked as "1" in output) often means it's not writable.
	system_linux_nfs_mountpoint_availability	System Linux NFS Mountpoint Availability	-	Monitors the availability of NFS Mount points. The availability status of mount points is often determined by checking whether the NFS mount point is present in the current list of NFS shares compared to the list stored in the previous state. If a mount point was present in the previous state but is not in the current state, it is marked as "1" (not available). If it is present in both states, it is marked as "0" (available).

Agent G2 - Linux NFS Mount Point Monitoring - v4

Description

Monitors the Linux NFS mount points availability, accessibility, and utilization.In Version 4 of the template, we introduced enhanced functionality to monitor user-specific mounts accessibility. Additionally, users now have the flexibility to choose between monitoring all mounts or exclusively focusing on permanent mount points (i.e. only nfs mounts present in /etc/fstab).

Template Usage Guidelines:

While applying this template on the device, users need to provide specific input parameters in below two formats only (Case-Insensitive).

Format 1: All (This format monitors both temporary and permanent mount points)
Format 2: Permanent (This format monitors only Permanent Mounts which are available in \etc\fstab file)

Prerequisites

NFS needs to be installed and NFS Mount points should be available on target device.

Supported Metric

Monitor Name	Monitor Description	Metric Name	Metric Display Name	Unit	Metric Description
Agent G2 - Linux NFS Mount Point Custom Monitor - v4	Monitors the Linux NFS mount points availability, accessibility, and utilization	system_linux_nfs_mountpoint_utilization	System Linux NFS Mountpoint Utilization	Percentage	Monitors the NFS Mount points utilization.
		system_linux_nfs_mountpoint_accessibility	System Linux NFS Mountpoint Accessibility		Monitors the accessibility of NFS Mount points. An accessible NFS mount point typically means both read and write access(marked as “0” in output), and inaccessibility (marked as “1” in output) often means it’s not writable.
		system_linux_nfs_mountpoint_availability	System Linux NFS Mountpoint Availability		Monitors the availability of NFS Mount points. The availability status of mount points is often determined by checking whether the NFS mount point is present in the current list of NFS shares compared to the list stored in the previous state. If a mount point was present in the previous state but is not in the current state, it is marked as “1” (not available). If it is present in both states, it is marked as “0” (available).

Agent G2 - Linux - Nginx Monitors

Description

Monitors Nginx application metrics

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - Nginx Monitors	nginx.connections.writing	Nginx Writing Connections	NULL	Nginx reads the request body, processes the request or writes response to a client.
	nginx.perconnections_requests	Nginx Requests per connection	Requests / conn	Average number of requests per connection.
	nginx.connections.reading	Nginx Reading Connections	NULL	Nginx reads the request header.
	nginx.connections.active	Nginx Connections	Active Connections	Number of all open connections including connections to backends.
	nginx.requests.handled	Nginx Handled Requests	requests	The number of requests served by connections handled by Nginx.
	nginx.requests_rate	Nginx Requests Rate	requests / sec	Average number of requests per second.
	nginx.connections_rate	Nginx Connections Rate	Connections / sec	Average number of connections per second.
	nginx.response.time	Nginx Response Time	Seconds	Time taken for Nginx request-response.
	nginx.connections.waiting	Nginx Waiting Connections	NULL	Keep-alive connections, actually it will be active - (reading + writing).

Agent G2 - Linux - NGINX Perfomance Check

Description

Monitors Nginx application metrics. This requires Nginx to be compiled with the Stub Status module.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - NGINX Perfomance Check	nginx.requests.handled	Nginx Handled Requests	NULL	The number of requests served by connections handled by Nginx.
	nginx.connections.reading	Nginx Reading Connections	NULL	Nginx reads the request header.
	nginx.response.time	Nginx Response Time	NULL	Time taken for Nginx request-response.
	nginx.requests_rate	Nginx Requests Rate	NULL	Average number of requests per second.
	nginx.connections.writing	Nginx Writing Connections	NULL	Nginx reads the request body, processes the request or writes response to a client.
	nginx.perconnections_requests	Nginx Requests per connection	NULL	Average number of requests per connection.
	nginx.connections.waiting	Nginx Waiting Connections	NULL	Keep-alive connections, actually it will be active - (reading + writing).
	nginx.connections_rate	Nginx Connections Rate	NULL	Average number of connections per second.
	nginx.connections.active	Nginx Connections	NULL	Number of all open connections including connections to backends.

Agent G2 - Linux - NTP Monitoring Offset

Description

Monitoring delay in seconds

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - NTP Monitoring Offset	ntp.offset	Ntp Offset	NULL	The time difference between the local clock and the NTP reference clock

Agent G2 - Linux NTP Statistics

Description

Monitors the NTP offset and jitter values of only system peer (the remote NTP server marked with a * at the beginning) for Linux systems.

Prerequisites

NTP needs to be installed and need Root privileges to execute the script.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux NTP Statistics	system_linux_NTP_offset	System Linux NTP Offset	milliseconds	Monitors the time offset between the system clock and the Network Time Protocol (NTP) reference, indicating how much the system clock is ahead or behind the NTP reference.
Agent G2 - Linux NTP Statistics	system_linux_NTP_jitter	System Linux NTP Jitter	milliseconds	Monitors the jitter in the Network Time Protocol (NTP) synchronization, which reflects the variability in timekeeping accuracy. It measures the short-term fluctuations in the time offset between the system clock and the NTP reference.

Agent G2 - Linux - Nvidia GPU Monitoring

Description

Monitors Nvidia GPU Metrics like Gpu utilization, Power usage, Memory usage and Temperature per Gpu instance

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Nvidia Gpu Monitor	nvidia_dcgm_fb_mem_used	Nvidia Dcgm Framebuffer Memory Used	Percentage	Framebuffer Memory Used
	nvidia_dcgm_memory_temp	Nvidia Dcgm Memory Temp	Celsius	Memory temperature
	nvidia_dcgm_gpu_util	Nvidia Dcgm Gpu Util	Percentage	GPU utilization
	nvidia_dcgm_mem_copy_util	Nvidia Dcgm Mem Util	Percentage	Memory utilization
	nvidia_dcgm_gpu_temp	Nvidia Dcgm Gpu Temp	Celsius	GPU temperature
	nvidia_dcgm_power_usage	Nvidia Dcgm Power Usage	Watts	Power draw
	nvidia_dcgm_mem_clock	Nvidia Dcgm Mem Clock Freq	Megahertz	Memory clock frequency

Agent G2 - Linux - OKD ApiServer

Description

Template for monitoring OKD through Kubernetes API server

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - OKD ApiServer	apiserver.rest.client.requests.total.count	Kube apiserver Rest Client Requests Total Count	NULL	Number of HTTP requests, partitioned by status code, method, and host.
	apiserver.dropped.requests.total.count	Kube apiserver Dropped Requests Total Count	NULL	Monotonic count of requests dropped with Try-again-later response.
	apiserver.request.duration.seconds.bucket	Kube apiserver Request Duration Seconds Bucket	histogram	Response latency distribution in seconds for each verb, dry run value, group, version, resource, subresource, scope, and component.
	apiserver.request.count	Kube apiserver Request Count	NULL	Counter of apiserver requests broken out for each verb, group, version, resource, scope, component, client, and HTTP response contentType and code.
	apiserver.APIServiceRegistrationController.depth	Kube apiserver APIService Registration Controller Depth	NULL	Current depth of workqueue: APIServiceRegistrationController.
	apiserver.rest.client.requests.total	Kube apiserver Rest Client Requests Total	NULL	Number of HTTP requests, partitioned by status code, method, and host.
	apiserver.audit.event.total	Kube apiserver Audit Event Total	NULL	Counter of audit events generated and sent to the audit backend.
	apiserver.go.goroutines	Kube apiserver Goroutines	NULL	Number of goroutines that currently exist.
	apiserver.inflight.requests	Kube apiserver Inflight Requests	NULL	Maximal number of currently used inflight request limit of this apiserver per request kind in the last second.
	apiserver.go.threads.total	Kube apiserver Go Threads Total	NULL	Number of OS threads created.
	apiserver.authenticated.user.requests	Kube apiserver Authenticated User Requests	NULL	Counter of authenticated requests broken out by username.
	apiserver.etcd.object.counts	Kube apiserver ETCD Object Counts	NULL	Number of stored objects at the time of the last check split by kind.
	apiserver.http.requests.total.count	Kube apiserver HTTP Requests Total Count	NULL	Total number of HTTP requests made.
	apiserver.request.count.count	Kube apiserver Request Count Count	NULL	Counter of apiserver requests broken out for each verb, group, version, resource, scope, component, client, and HTTP response contentType and code.
	apiserver.authenticated.user.requests.count	Kube apiserver Authenticated User Requests Count	NULL	Counter of authenticated requests broken out by username.
	apiserver.http.requests.total	Kube apiserver HTTP Requests Total	NULL	Total number of HTTP requests made.

Agent G2 - Linux - OKD CoreDNS

Description

Kubernetes CoreDNS

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - OKD CoreDNS	coredns.request_duration.seconds.sum	Request Duration Seconds Sum	NULL	Duration to process each query.
	coredns.query.count	Query count	NULL	Total query count.
	coredns.response_size.bytes.sum	Response Size Bytes Sum	NULL	Size of the returned response in bytes.
	coredns.request_duration.seconds.count	Request Duration Seconds Count	NULL	Duration per upstream interaction.
	coredns.panics	Total Panics	NULL	Total number of panics.

Agent G2 - Linux - OKD Kube Controller

Description

Template for monitoring OKD using Kube Controller

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - OKD Kube Controller	controller.workqueue.work_unfinished_duration	Kube Controller Workqueue Unfinished Work Seconds	NULL	How many seconds of work has done that is in progress and hasn't been observed by work_duration. Large values indicate stuck threads.
	controller.go.goroutines	Kube Controller Go Goroutines	NULL	Number of goroutines that currently exist.
	controller.workqueue.adds	Kube Controller Workqueue Adds Total	NULL	Total number of adds handled by workqueue.
	controller.process.open_fds	Kube Controller Process Open Fds	NULL	Number of open file descriptors.
	controller.workqueue.retries	Kube Controller Workqueue Retries Total	NULL	Total number of retries handled by workqueue.
	controller.workqueue.nodes.count	Kube Controller Registered Nodes	NULL	Number of registered Nodes per zones.
	controller.workqueue.work_duration.sum	Kube Controller Workqueue Work Duration Seconds Sum	NULL	How long in seconds processing an item from workqueue takes.
	controller.workqueue.depth	Kube Controller Workqueue Depth	NULL	Current depth of workqueue.
	controller.workqueue.work_duration.count	Kube Controller Workqueue Work Duration Seconds Count	NULL	Total time in seconds processing an item from workqueue takes.
	controller.workqueue.nodes.evictions	Kube Controller Node Collector Evictions Number	NULL	Number of Node evictions that happened since the current instance of NodeController started.
	controller.threads	Kube Controller OS Threads	NULL	Number of OS threads created.
	controller.workqueue.work_longest_duration	Kube Controller Workqueue Longest Running Processor Seconds	NULL	How many seconds has the longest running processor for workqueue been running.
	controller.rate_limiter.use	Kube Controller Node Lifecycle Controller Rate Limiter Use	NULL	A metric measuring the saturation of the rate limiter for node_lifecycle_controller.
	controller.process.max_fds	Kube Controller Process Max Fds	NULL	Maximum number of open file descriptors.
	controller.workqueue.queue_duration.sum	Kube Controller Workqueue Queue Duration Seconds Sum	NULL	How long in seconds an item stays in workqueue before being requested.
	controller.workqueue.queue_duration.count	Kube Controller Workqueue Queue Duration Seconds Count	NULL	Total how long in seconds an item stays in workqueue before being requested.
	controller.workqueue.nodes.unhealthy	Kube Controller Node Collector Unhealthy Nodes in Zone	NULL	Number of not Ready Nodes per zones.

Agent G2 - Linux - Postfix Monitors

Description

Monitors postfix queues

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - Postfix Monitors	postfix.queues.deferred	Postfix Queues Deferred	NULL	Postfix deferred mails queues count
	postfix.queues.bounce	Postfix Queues Bounce	NULL	Postfix bounce mails queues count
	postfix.queues.maildrop	Postfix Queues Maildrop	NULL	Postfix maildrop mails queues count
	postfix.queues.incoming	Postfix Queues Incoming	NULL	Postfix incoming mail queues count
	postfix.queues.active	Postfix Queues Active	NULL	Postfix active mails queues count

Agent G2 - Linux - OKD Kube Scheduler

Description

Template for monitoring OKD using Kube Scheduler

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - OKD Kube Scheduler	scheduler.client.http.requests_duration.count	Kube Scheduler Rest Client Request Latency Seconds Count	NULL	Total request latency in seconds. Broken down by verb and URL.
	scheduler.binding.latency.count	Kube Scheduler Binding Latency Microseconds Count	NULL	Total Binding latency in microseconds count.
	scheduler.scheduling.scheduling_latency.count	Kube Scheduler Scheduling Latency Seconds Count	NULL	Scheduling latency in seconds split by sub-parts of the scheduling operation.
	scheduler.scheduling.scheduling_duration.quantile	Kube Scheduler Scheduling Duration Seconds	NULL	Scheduling latency in seconds split by sub-parts of the scheduling operation.
	scheduler.volume_scheduling_duration.sum	Kube Scheduler Volume Scheduling Duration Seconds Sum	NULL	Volume scheduling stage latency sum.
	scheduler.volume_scheduling_duration.count	Kube Scheduler Volume Scheduling Duration Seconds Count	NULL	Volume scheduling stage latency count.
	scheduler.go.goroutines	Kube Scheduler Go Goroutines	NULL	Number of goroutines that currently exist.
	scheduler.pod_preemption.victims	Kube Scheduler Pod Preemption Victims	NULL	Number of selected preemption victims.
	scheduler.scheduling.algorithm.preemption_duration.sum	Kube Scheduler Scheduling Algorithm Preemption Evaluation Sum	NULL	Scheduling algorithm preemption evaluation duration.
	scheduler.gc_duration_seconds.sum	Kube Scheduler Go GC Duration Seconds Sum	NULL	A summary of the GC invocation durations.
	scheduler.client.http.requests	Kube Scheduler Rest Client Requests Total	NULL	Number of HTTP requests, partitioned by status code, method, and host.
	scheduler.e2e.scheduling_latency.sum	Kube Scheduler E2E Scheduling Latency Microseconds Sum	NULL	E2e scheduling latency in microseconds (scheduling algorithm + binding).
	scheduler.scheduling.scheduling_duration.sum	Kube Scheduler Scheduling Duration Seconds Sum	NULL	Scheduling latency in seconds split by sub-parts of the scheduling operation.
	scheduler.e2e.scheduling_duration.sum	Kube Scheduler E2E Scheduling Duration Seconds Sum	NULL	E2e scheduling latency in seconds (scheduling algorithm + binding).
	scheduler.binding.latency.sum	Kube Scheduler Binding Latency Microseconds Sum	NULL	Binding latency in microseconds sum.
	scheduler.scheduling.scheduling_duration.count	Kube Scheduler Scheduling Duration Seconds Count	NULL	Scheduling latency in seconds split by sub-parts of the scheduling operation.
	scheduler.scheduling.scheduling_latency.quantile	Kube Scheduler Scheduling Latency Seconds	NULL	Scheduling latency in seconds split by sub-parts of the scheduling operation.
	scheduler.e2e.scheduling_duration.count	Kube Scheduler E2E Scheduling Duration Seconds Count	NULL	Total E2e scheduling latency in seconds (scheduling algorithm + binding).
	scheduler.binding.duration.count	Kube Scheduler Binding Duration Seconds Count	NULL	Total Binding duration in seconds count.
	scheduler.threads	Kube Scheduler OS Threads	NULL	Number of OS threads created.
	scheduler.binding.duration.seconds	Kube Scheduler Binding Duration Seconds Sum	NULL	Binding duration in seconds sum.
	scheduler.pod_preemption.attempts	Kube Scheduler Total Preemption Attempts	NULL	Total preemption attempts in the cluster till now.
	scheduler.process.open_fds	Kube Scheduler Process Open Fds	NULL	Number of open file descriptors.
	scheduler.scheduling.scheduling_latency.sum	Kube Scheduler Scheduling Latency Seconds Sum	NULL	Scheduling latency in seconds split by sub-parts of the scheduling operation.
	scheduler.client.http.requests_duration.sum	Kube Scheduler Rest Client Request Latency Seconds Sum	NULL	Request latency in seconds sum. Broken down by verb and URL.
	scheduler.schedule_attempts.total	Kube Scheduler Schedule Attempts Total	NULL	Number of attempts to schedule pods, by the result. 'unschedulable' means a pod could not be scheduled, while 'error' means an internal scheduler problem.
	scheduler.gc_duration_seconds.quantile	Kube Scheduler Go GC Duration Seconds	NULL	A summary of the GC invocation durations.
	scheduler.scheduling.algorithm.preemption_duration.count	Kube Scheduler Scheduling Algorithm Preemption Evaluation Count	NULL	Scheduling algorithm preemption evaluation duration.
	scheduler.scheduling.algorithm.predicate_duration.sum	Kube Scheduler Scheduling Algorithm Predicate Evaluation Sum	NULL	Scheduling algorithm predicate evaluation duration.
	scheduler.scheduling.algorithm_duration.sum	Kube Scheduler Scheduling Algorithm Duration Seconds Sum	NULL	Scheduling algorithm latency in seconds sum.
	scheduler.scheduling.algorithm.preemption_duration.count	Kube Scheduler Scheduling Algorithm Preemption Evaluation Count	NULL	Scheduling algorithm preemption evaluation duration.
	scheduler.e2e.scheduling_latency.count	Kube Scheduler E2E Scheduling Latency Microseconds Count	NULL	Total E2e scheduling latency in microseconds (scheduling algorithm + binding).
	scheduler.scheduling.algorithm.predicate_duration.count	Kube Scheduler Scheduling Algorithm Predicate Evaluation Count	NULL	Scheduling algorithm predicate evaluation duration.
	scheduler.scheduling.algorithm_duration.count	Kube Scheduler Scheduling Algorithm Duration Seconds Count	NULL	Total Scheduling algorithm latency in seconds count.
	scheduler.scheduling.algorithm.priority_duration.sum	Kube Scheduler Scheduling Algorithm Priority Evaluation Sum	NULL	Scheduling algorithm priority evaluation duration.
	scheduler.scheduling.algorithm_latency.sum	Kube Scheduler Scheduling Algorithm Latency Microseconds Sum	NULL	Scheduling algorithm latency in microseconds sum.
	scheduler.gc_duration_seconds.count	Kube Scheduler Go GC Duration Seconds Count	NULL	A summary of the GC invocation durations.
	scheduler.scheduling.algorithm_latency.count	Kube Scheduler Scheduling Algorithm Latency Microseconds Count	NULL	Total Scheduling algorithm latency in microseconds count.
	scheduler.cache.lookups	Kube Scheduler Equiv Cache Lookups Total	NULL	Total number of equivalence cache lookups, by whether or not a cache entry was found.
	scheduler.process.max_fds	Kube Scheduler Process Max Fds	NULL	Maximum number of open file descriptors.

Agent G2 - Linux - OKD Kube State

Description

Template for monitoring OKD using Kube State

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - OKD Kube State	kubernetes_state.node.cpu_allocatable	Node Cpu Allocatable	NULL	The CPU resources of a node that are available for scheduling.
	kubernetes_state.resourcequota.requests.storage.used	Resourcequota Requests Storage Used	NULL	Observed sum of storage bytes requested for a resource quota.
	kubernetes_state.resourcequota.persistentvolumeclaims.limit	Resourcequota Persistentvolumeclaims Limit	NULL	Hard limit of the number of PVC for a resource quota.
	kubernetes_state.node.cpu_capacity	Node Cpu Capacity	NULL	The total CPU resources of the node.
	kubernetes_state.replicaset.replicas_desired	Replicaset Replicas Desired	NULL	Number of desired pods for a ReplicaSet.
	kubernetes_state.resourcequota.pods.limit	Resourcequota Pods Limit	NULL	Hard limit of the number of pods for a resource quota.
	kubernetes_state.replicaset.replicas_ready	Replicaset Replicas Ready	NULL	The number of ready replicas per ReplicaSet.
	kubernetes_state.deployment.replicas_unavailable	Deployment Replicas Unavailable	NULL	The number of unavailable replicas per deployment.
	kubernetes_state.resourcequota.requests.memory.limit	Resourcequota Requests Memory Limit	NULL	Hard limit on the total of memory bytes requested for a resource quota.
	kubernetes_state.resourcequota.limits.cpu.limit	Resourcequota Limits Cpu Limit	NULL	Hard limit on the sum of CPU core limits for a resource quota.
	kubernetes_state.resourcequota.requests.memory.used	Resourcequota Requests Memory Used	NULL	Observed sum of memory bytes requested for a resource quota.
	kubernetes_state.replicaset.replicas	Replicaset Replicas	NULL	The number of replicas per ReplicaSet.
	kubernetes_state.resourcequota.limits.memory.limit	Resourcequota Limits Memory Limit	NULL	Hard limit on the sum of memory bytes limits for a resource quota.
	kubernetes_state.resourcequota.requests.cpu.used	Resourcequota Requests Cpu Used	NULL	Observed sum of CPU cores requested for a resource quota.
	kubernetes_state.resourcequota.services.nodeports.limit	Resourcequota Services Nodeports Limit	NULL	Hard limit of the number of node ports for a resource quota.
	kubernetes_state.daemonset.scheduled	Daemonset Scheduled	NULL	The number of nodes running at least one daemon pod and are supposed to.
	kubernetes_state.deployment.replicas_updated	Deployment Replicas Updated	NULL	The number of updated replicas per deployment.
	kubernetes_state.container.memory_requested	Container Memory Requested	NULL	The number of requested memory bytes by a container.
	kubernetes_state.container.cpu_limit	Container Cpu Limit	NULL	The limit on cpu cores to be used by a container.
	kubernetes_state.container.restarts	Container Restarts	NULL	The number of restarts per container.
	kubernetes_state.resourcequota.pods.used	Resourcequota Pods Used	NULL	Observed number of pods used for a resource quota.
	kubernetes_state.resourcequota.persistentvolumeclaims.used	Resourcequota Persistentvolumeclaims Used	NULL	Observed number of persistent volume claims used for a resource quota.
	kubernetes_state.resourcequota.limits.memory.used	Resourcequota Limits Memory Used	NULL	Observed sum of limits for memory bytes for a resource quota.
	kubernetes_state.deployment.replicas_available	Deployment Replicas Available	NULL	The number of available replicas per deployment.
	kubernetes_state.daemonset.misscheduled	Daemonset Misscheduled	NULL	The number of nodes running a daemon pod but are not supposed to.
	kubernetes_state.resourcequota.requests.cpu.limit	Resourcequota Requests Cpu Limit	NULL	Hard limit on the total of CPU core requested for a resource quota.
	kubernetes_state.resourcequota.limits.cpu.used	Resourcequota Limits Cpu Used	NULL	Observed sum of limits for CPU cores for a resource quota.
	kubernetes_state.resourcequota.services.loadbalancers.limit	Resourcequota Services Loadbalancers Limit	NULL	Hard limit of the number of loadbalancers for a resource quota.
	kubernetes_state.container.memory_limit	Container Memory Limit	NULL	The limit on memory to be used by a container.
	kubernetes_state.resourcequota.services.nodeports.used	Resourcequota Services Nodeports Used	NULL	Observed number of node ports used for a resource quota.
	kubernetes_state.resourcequota.services.limit	Resourcequota Services Limit	NULL	Hard limit of the number of services for a resource quota.
	kubernetes_state.node.pods_capacity	Node Pods Capacity	NULL	The total pod resources of the node.
	kubernetes_state.node.memory_allocatable	Node Memory Allocatable	NULL	The memory resources of a node that are available for scheduling.
	kubernetes_state.container.cpu_requested	Container Cpu Requested	NULL	The number of requested cpu cores by a container.
	kubernetes_state.deployment.rollingupdate.max_unavailable	Deployment Rollingupdate Max Unavailable	NULL	Maximum number of unavailable replicas during a rolling update of a deployment.
	kubernetes_state.daemonset.ready	Daemonset Ready	NULL	The number of nodes that should be running the daemon pod and have one or more of the daemon pod running and ready.
	kubernetes_state.deployment.replicas_desired	Deployment Replicas Desired	NULL	The number of desired replicas per deployment wrong help in kube-state-metrics.cross check
	kubernetes_state.resourcequota.services.used	Resourcequota Services Used	NULL	Observed number of services used for a resource quota.
	kubernetes_state.daemonset.desired	Daemonset Desired	NULL	The number of nodes that should be running the daemon pod.
	kubernetes_state.resourcequota.services.loadbalancers.used	Resourcequota Services Loadbalancers Used	NULL	Observed number of loadbalancers used for a resource quota.
	kubernetes_state.node.pods_allocatable	Node Pods Allocatable	NULL	The pod resources of a node that are available for scheduling.
	kubernetes_state.resourcequota.requests.storage.limit	Resourcequota Requests Storage Limit	NULL	Hard limit on the total of storage bytes requested for a resource quota.
	kubernetes_state.replicaset.fully_labeled_replicas	Replicaset Fully Labeled Replicas	NULL	The number of fully labeled replicas per ReplicaSet.
	kubernetes_state.node.memory_capacity	Node Memory Capacity	NULL	The total memory resources of the node.
	kubernetes_state.deployment.replicas	Deployment Replicas	NULL	The number of replicas per deployment.

Agent G2 - Linux - OS DISKIOPS Template

Description

Agent G2 - Linux - OS DISKIOPS Template

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - OS DISKIOPS Template	DISKIOPS	DISKIOPS	NULL	Monitors the Disk I/O Read in MBps, Disk Write MBps and Disk busy percentage.

Agent G2 - Linux Postfix Statistics

Description

Monitors the counts and sizes of specific mail queue types - namely, incoming, active, maildrop, deferred, and bounce queues.

Prerequisites:

Postfix needs to be installed and need Root privileges to execute the script.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux Postfix Statistics	system_linux_postfix_active_mailqueue_size	System Linux Postfix Active Mailqueue Size	Bytes	Monitors the size (in bytes) of active emails in the Postfix mail queue.
	system_linux_postfix_deferred_mailqueue_size	System Linux Postfix Deferred Mailqueue Size	Bytes	**Monitors the size (in bytes) of deferred emails in the Postfix mail queue.
	system_linux_postfix_maildrop_mailqueue_size	System Linux Postfix Maildrop Mailqueue Size	Bytes	Monitors the size (in bytes) of emails in the Postfix mail queue marked for maildrop.
	system_linux_postfix_bounce_mailqueue_size	System Linux Postfix Bounce Mailqueue Size	Bytes	Monitors the size (in bytes) of bounced emails in the Postfix mail queue.
	system_linux_postfix_incoming_mailqueue_size	System Linux Postfix Incoming Mailqueue Size	Bytes	Monitors the size (in bytes) of incoming emails in the Postfix mail queue.
	system_linux_postfix_deferred_mailqueue_count	System Linux Postfix Deferred Mailqueue Count	Count	Monitors the count of deferred emails in the Postfix mail queue.
	system_linux_postfix_bounce_mailqueue_count	System Linux Postfix Bounce Mailqueue Count	Count	Monitors the count of bounced emails in the Postfix mail queue.
	system_linux_postfix_maildrop_mailqueue_count	System Linux Postfix Maildrop Mailqueue Count	Count	Monitors the count of emails in the Postfix mail queue marked for maildrop.
	system_linux_postfix_incoming_mailqueue_count	System Linux Postfix Incoming Mailqueue Count	Count	Monitors the count of incoming emails in the Postfix mail queue.
	system_linux_postfix_active_mailqueue_count	system_linux_postfix_active_mailqueue_count	Count	Monitors the count of active emails in the Postfix mail queue.

Agent G2 - Linux - PostgresDB Aliveness Check Status

Description

To monitor Postgresql db_aliveness, Supported versions of PostgreSQL 11 or later (Validated this template on version PostgreSQL-11 and 12 versions).

Prerequisites

Agent installed on the target machine.
Create a Postgres environment file and provide the file path as input parameter while applying the template.
We need to provide env path for single instance - <env path> & for multiple instances - <env path1>, <env path2>,<env path3> Along with setting up postgres environment this env file should contain other parameters like PGDATABASE,PGARCHIVEDIR,PGDATADIR,PGWALDIR,PGPORT,SERVICENAME.
Agent must have permission to access the provided .env file

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - PostgresDB Aliveness Check Status Monitor	postgres_check_dbalive	Postgres Check DBAlive	NULL	To monitor the aliveness of the postgres database

Agent G2 - Linux - PostgresDB Aliveness Check Status - v2

Description

To monitor the aliveness of the postgres database

Template Usage Guidelines:

Create a Postgres environment file and provide the file path as input parameter while applying the template.
We need to provide env path for single instance - <env path> & for multiple instances - <env path1>,<env path2>,<env path3>
Along with setting up postgres environment, this env file should contain other parameters like PGDATABASE,PGARCHIVEDIR,PGDATADIR,PGWALDIR,PGPORT,SERVICENAME.
Agent must have permission to access the provided .env file.
Sample pg_new_5432.env file data: export PATH=$PATH:/usr/pgsql-12/bin/ PGDATABASE=postgres PGPORT=5432 PGARCHIVEDIR=/var/lib/pgsql/backups_main/archive/ PGDATADIR=/var/lib/pgsql/12/data PGWALDIR=/var/lib/pgsql/12/data/pg_wal SERVICENAME=postgresql-12

Prerequisite

Agent must be installed on the target machine.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - PostgresDB Aliveness Check Status Monitor - v2	postgres_check_dbalive	Postgres Check DBAlive		To monitor the aliveness of the postgres database

Agent G2 - Linux - PostgreSQL Monitors

Description

Agent G2 - Linux - PostgreSQL Monitors

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - PostgreSQL Monitors	postgres.dbstat.commit	PostgreSQL Commits	NULL	The total number of commits for this database since it was created or reset.
	postgres.dbstat.reads	PostgreSQL Reads	NULL	Reports information from the pg_stat_database view, The total number of disk blocks read.
	postgres.conn.idle	PostgreSQL Connections Idle	NULL	Checks number of connections idle in given state
	postgres.db.size	PostgreSQL Database Size	MB	Total Size of all dbs
	postgres.locks.not.granted	PostgreSQL Locks Not Granted	NULL	Checks the total number of locks are not granted on one or more databases
	postgres.conn.waiting	PostgreSQL Connections Waiting	NULL	Checks number of connections waiting in given state
	postgres.dbstat.tup.inserted	PostgreSQL Tup Inserted	NULL	Reports information from the pg_stat_database view, The total number of tuples inserted.
	postgres.autovac.freeze	PostgreSQL Autovac Freeze	%	Provides the percentage of current transactions to the max freeze number.
	postgres.backends	PostgreSQL Backends	%	Check the number of connections to the database. Compares it with the Max_connection provided in the postgres conf file
	postgres.dbstat.tup.returned	PostgreSQL Tup Returned	NULL	Reports information from the pg_stat_database view, The total number of tuples returned.
	postgres.dbstat.hits	PostgreSQL Hits	NULL	Reports information from the pg_stat_database view , The total number of buffer hits.
	postgres.tnxage.running	PostgreSQL Tnxage Running	NULL	Checks the number and duration of "running transaction" queries on one or more databases
	postgres.locks.granted	PostgreSQL Locks Granted	NULL	Checks the total number of locks are granted on one or more databases
	postgres.bloat	PostgreSQL Bloat	NULL	Checks the amount of bloat in tables and indexes
	postgres.dbstat.rollback	PostgreSQL Rollbacks	NULL	The total number of rollbacks for this database since it was created or reset.
	postgres.dbstat.tup.deleted	PostgreSQL Tup Deleted	NULL	Reports information from the pg_stat_database view, The total number of tuples deleted.
	postgres.conn.total	PostgreSQL Connections Total	NULL	Checks total number of connections in given state
	postgres.conn.running	PostgreSQL Connections Running	NULL	Checks number of connections running in given state
	postgres.ping	PostgreSQL Ping	NULL	Provides the Ping response time of PostgreSQL database.
	postgres.dbstat.tup.fetched	PostgreSQL Tup Fetched	NULL	Reports information from the pg_stat_database view, The total number of tuples fetched.
	postgres.conn.idle.tnx	PostgreSQL Connections Idle Tnx	NULL	Checks the number connections "idle in transaction" state
	postgres.locks.all	PostgreSQL Locks	NULL	Checks the total number of locks on one or more databases
	postgres.tnxage.idle.tnx	PostgreSQL Tnxage IdleTnx	NULL	Checks the number and duration of "idle in transaction" queries on one or more databases
	postgres.dbstat.tup.updated	PostgreSQL Tup Updated	NULL	Reports information from the pg_stat_database view, The total number of tuples updated.
	postgres.wal	PostgreSQL Wal	NULL	Checks how many WAL files exist in the pg_xlog directory

Agent G2 - Linux PostgresDB Aliveness Check Status - v3

Description:

Monitors the PostgreSQL database aliveness status. The metric value is 1 if the PostgreSQL database is alive; otherwise, the value is 0.

Prerequisites:

The Agent must be installed as Root on the target machine, with Agent version 14.0 or later.
Create a PostgreSQL environment file and provide the file path as an input parameter when applying the template.
For a single instance, provide the environment path as <env path>. For multiple instances, provide the environment paths as <env path1>, <env path2>, <env path3>.
This env file should contain other parameters such as PGDATADIR, PGPORT, SERVICENAME, SERVICELEVEL, POSTGRESUSER, and POSTGRESPATH. The last three parameters (SERVICELEVEL, POSTGRESUSER, POSTGRESPATH) are necessary only for checking the status of PostgreSQL using pg_ctl; otherwise, they are optional.
The agent must have execute permissions on the provided .env file.

The enhancements introduced in Version 3 (V3) of the script provide users with the flexibility to check the PostgreSQL aliveness status using either systemctl, pg_isready commands, or a combination of pg_isready and pg_ctl commands by giving respective parameters in env file as input.

Template Usage Guidelines: While assigning template on device, users need to pass specific input parameters -

For a single instance, provide the environment path as <env path>. For multiple instances, provide the environment paths as <env path1>, <env path2>, <env path3>.

Example:
Single Input Parameter:
/root/pg_new_5432.env

Multiple Input Parameters: /var/lib/pgsql/pg_new_5432.env,/var/lib/pgsql/pg_new_5433.env

Create a Postgres environment file and provide the file path as input parameter while applying the template.
We need to provide env path for single instance - <env path> & for multiple instances - <env path1>,<env path2>,<env path3>
Along with setting up postgres environment, this env file should contain other parameters like PGDATABASE,PGARCHIVEDIR,PGDATADIR,PGWALDIR,PGPORT,SERVICENAME.
Agent must have permission to access the provided .env file Example content of the .env file -

SampleContent while checking postgres status with pg_ctl command:

export PATH=$PATH:/usr/pgsql-12/bin/        
PGPORT=5432         
PGDATADIR=/var/lib/pgsql/12/data            
SERVICENAME=postgresql-12           
SERVICELEVEL=pgctl          
POSTGRESUSER=postgres           
POSTGRESPATH=/usr/pgsql-12/bin/

SampleContent while checking postgres status without pg_ctl:

export PATH=$PATH:/usr/pgsql-12/bin/        
PGPORT=5432         
PGDATADIR=/var/lib/pgsql/12/data            
SERVICENAME=postgresql-12

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux PostgresDB Aliveness Check Status Monitor - v3	postgres_check_dbalive	Postgres Check DBAlive	-	To monitor the aliveness of the postgres database

Agent G2 - Linux OS Performance Monitoring - Advanced

Description

Template to monitor Linux OS advanced performance metrics related to OS Resource parameters, Real memory (page outs & scan rate), Total and individual swap utilization. It has been validated on following Linux flavors: RHEL 7.9, Centos 7 ,Ubuntu 20.04, Open SUSE Linux.

Prerequisites

Applicable on devices which is running Opsramp Agent ( v7.0.0 or above)

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux OS Resource Parameters	system_linux_openFileDescriptors_UsedCount	System Linux OpenFileDescriptors Used Count	count	Current number of Open File Descriptors
	system_linux_messageQueueIDs_Utilization	System Linux MessageQueueIDs Utilization	%	Used percentage of current message queue ID's
	system_linux_Semaphores_Utilization	System Linux Semaphores Utilization	%	Semaphore arrays or sets used percentage
	system_linux_loggedInUsers_Pct	System Linux Logged In Users Pct	%	Current number of logged in users percentage
	system_linux_sharedMemoryIDs_Utilization	System Linux SharedMemoryIDs Utilization	%	Used percentage of shared memory ID's
	system_linux_messageQueueIDs_UsedCount	System Linux MessageQueueIDs Used Count	count	Current number of message queue ID’s in use
	system_linux_openFileDescriptors_Utilization	System Linux OpenFileDescriptors Utilization	%	Linux Open File Descriptors Used Percentage
	system_linux_runningProcesses_Pct	System Linux Running Processes Pct	%	Current running processes percentage
	system_linux_Semaphores_UsedCount	System Linux Semaphores Used Count	count	Current number of semaphore arrays in use
	system_linux_sharedMemoryIDs_UsedCount	System Linux SharedMemoryIDs Used Count	count	Current number of shared memory ID’s in use
	system_linux_loggedInUsers_Count	System Linux LoggedInUsers Count	count	Current number of logged in users
	system_linux_runningProcesses_Count	System Linux RunningProcesses Count	count	Current number of running processes
Agent G2 - Linux Real Memory Stats	system_linux_RealMemory_PageOuts_KiloBytesPerSec	System Linux Real Memory PageOuts KiloBytesPerSec	KBps	Memory pages page out rate in Kilo Bytes per second.
	system_linux_RealMemory_PageOuts_PagesPerSec	System Linux Real Memory PageOuts PagesPerSec	psec	Memory page out rate in pages per second.
	system_linux_RealMemory_Scan_Rate	System Linux Real Memory Scan Rate	psec	Number of pages scanned (directly) per second. It will collect data for last 10 min (i.e time configured in /etc/cron.d/sysstat file).\n\nPrerequisite: sysstat package should be installed and sar -B command should respond
Agent G2 - Linux Swap Memory Utilization	system_linux_swapMemory_Utilization	System Linux Swap Memory Utilization	%	Swap memory utilization in percent.
Agent G2 - Linux Swap Memory Utilization	system_linux_individual_SwapArea_Utilization	System Linux Individual Swap Area Utilization	%	Individual swap area utilization in percent.

Agent G2 - Linux OS Performance Monitoring - Advanced - V2

Description

Template to monitor Linux OS advanced performance metrics related to OS Resource parameters, Real memory (page ins, page outs, swap in, swap out & scan rate), Total and individual swap utilization. It has been validated on following Linux flavors: RHEL 7.9, Centos 7 ,Ubuntu 20.04, Open SUSE Linux.

Prerequisites

Applicable on devices which is running Opsramp Agent ( v7.0.0 or above)

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux OS Resource Parameters	system_linux_openFileDescriptors_UsedCount	System Linux OpenFileDescriptors Used Count	count	Current number of Open File Descriptors
	system_linux_messageQueueIDs_Utilization	System Linux MessageQueueIDs Utilization	%	Used percentage of current message queue ID's
	system_linux_Semaphores_Utilization	System Linux Semaphores Utilization	%	Semaphore arrays or sets used percentage
	system_linux_loggedInUsers_Pct	System Linux Logged In Users Pct	%	Current number of logged in users percentage
	system_linux_sharedMemoryIDs_Utilization	System Linux SharedMemoryIDs Utilization	%	Used percentage of shared memory ID's
	system_linux_messageQueueIDs_UsedCount	System Linux MessageQueueIDs Used Count	count	Current number of message queue ID’s in use
	system_linux_openFileDescriptors_Utilization	System Linux OpenFileDescriptors Utilization	%	Linux Open File Descriptors Used Percentage
	system_linux_runningProcesses_Pct	System Linux Running Processes Pct	%	Current running processes percentage
	system_linux_Semaphores_UsedCount	System Linux Semaphores Used Count	count	Current number of semaphore arrays in use
	system_linux_sharedMemoryIDs_UsedCount	System Linux SharedMemoryIDs Used Count	count	Current number of shared memory ID’s in use
	system_linux_loggedInUsers_Count	System Linux LoggedInUsers Count	count	Current number of logged in users
	system_linux_runningProcesses_Count	System Linux RunningProcesses Count	count	Current number of running processes
Agent G2 - Linux Real Memory Stats - V2	system_linux_RealMemory_PageOuts_KiloBytesPerSec	System Linux Real Memory PageOuts KiloBytesPerSec	KBps	Memory pages page out rate in Kilo Bytes per second.
	system_linux_RealMemory_PageOuts_PagesPerSec	System Linux Real Memory PageOuts PagesPerSec	psec	Memory page out rate in pages per second.
	system_linux_RealMemory_Scan_Rate	System Linux Real Memory Scan Rate	psec	Number of pages scanned (directly) per second. It will collect data for last 10 min (i.e time configured in /etc/cron.d/sysstat file).\n\nPrerequisite: sysstat package should be installed and sar -B command should respond
	system_linux_RealMemory_SwapOuts_KiloBytesPerSec	System Linux Real Memory SwapOuts KiloBytesPerSec	KBps	Swap out rate in Kilo Bytes per second.
	system_linux_RealMemory_PageIns_PagesPerSec	System Linux Real Memory PageIns PagesPerSec	psec	Memory pages page in rate in Pages per second.
	system_linux_RealMemory_PageIns_KiloBytesPerSec	System Linux Real Memory PageIns KiloBytesPerSec	KBps	Memory pages page in rate in Kilo Bytes per second.
	system_linux_RealMemory_SwapIns_KiloBytesPerSec	System Linux Real Memory SwapIns KiloBytesPerSec	KBps	Swap in rate in Kilo Bytes per second.
Agent G2 - Linux Swap Memory Utilization	system_linux_swapMemory_Utilization	System Linux Swap Memory Utilization	%	Swap memory utilization in percent.
Agent G2 - Linux Swap Memory Utilization	system_linux_individual_SwapArea_Utilization	System Linux Individual Swap Area Utilization	%	Individual swap area utilization in percent.

Agent G2 - Linux OS Performance Monitoring - Advanced - v3

Description:

Monitors the data related to OS resource parameters like Open FDs,Logge In users, Context Switches, Processes created, Running processes, Page Faults, Semaphores, Shared Memory IDs,Message queue IDs, TCP Connection states, Swap memory, Real memory Statistics and disk statistics. Ensure that the “ss” command is available in system to get TCP Connections data and util-linux package version 2.19 or higher, Kernel version above 2.6 be available on the system to get Disk Stats data.
Note: When the server is rebooted or when the disk counter’s valid range is exceeded, negative values for disk metrics will occur, as we are calculating rates.

Prerequisites

Ensure that the “ss” command is available in system to get TCP Connections data and util-linux package version 2.19 or higher, Kernel version above 2.6 be available on the system to get Disk Stats data.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux Swap Memory Utilization	system_linux_swapMemory_Utilization	System Linux Swap Memory Utilization	%	Swap memory utilization in percent.
Agent G2 - Linux Swap Memory Utilization	system_linux_individual_SwapArea_Utilization	System Linux Individual Swap Area Utilization	%	Individual swap area utilization in percent.
Agent G2 - Linux Real Memory Stats - V2	system_linux_RealMemory_Scan_Rate	System Linux Real Memory Scan Rate	psec	Number of pages scanned (directly) per second. It will collect data for last 10 min (i.e time configured in /etc/cron.d/sysstat file). Prerequisite: sysstat package should be installed and sar -B command should respond
	system_linux_RealMemory_PageOuts_PagesPerSec	System Linux Real Memory PageOuts PagesPerSec	psec	Memory page out rate in pages per second.
	system_linux_RealMemory_PageOuts_KiloBytesPerSec	System Linux Real Memory PageOuts KiloBytesPerSec	KBps	Memory pages page out rate in Kilo Bytes per second.
	system_linux_RealMemory_PageIns_KiloBytesPerSec	System Linux Real Memory PageIns KiloBytesPerSec	KBps	Memory pages page in rate in Kilo Bytes per second.
	system_linux_RealMemory_PageIns_PagesPerSec	System Linux Real Memory PageIns PagesPerSec	psec	Memory pages page in rate in Pages per second.
	system_linux_RealMemory_SwapIns_KiloBytesPerSec	System Linux Real Memory SwapIns KiloBytesPerSec	KBps	Swap in rate in Kilo Bytes per second.
	system_linux_RealMemory_SwapOuts_KiloBytesPerSec	System Linux Real Memory SwapOuts KiloBytesPerSec	KBps	Swap out rate in Kilo Bytes per second.
Agent G2 - Linux TCP Connection States Monitor	system_linux_tcp_connection_states	System Linux TCP Connection States	count	Monitors the count of TCP connections in various states on the Linux system.
Agent G2 - Linux Disk Statistics	system_linux_disk_IOQueueLength	System Linux Disk IOQueueLength	null	Monitors the length of the I/O queue for disk operations.
	system_linux_disk_averageLatency	System Linux Disk AverageLatency	microsec	Monitors the average response time of the disk subsystem to process I/O requests.
	system_linux_disk_averageReadRequestSize	System Linux Disk AverageReadRequestSize	KB	Monitors the average size of read requests issued to the disk.
	system_linux_disk_averageRequestSize	System Linux Disk AverageRequestSize	KB	Monitors the average size of all read and write requests issued to the disk.
	system_linux_disk_averageWriteRequestSize	System Linux Disk AverageWriteRequestSize	KB	Monitors the average size of write requests issued to the disk.
	system_linux_disk_timeUtilization	System Linux Disk TimeUtilization	%	Monitors the utilization of the disk, measured as the percentage of time the disk is actively processing I/O operations.
	system_linux_disk_readOperationsRate	System Linux Disk ReadOperationsRate	Monitors the rate of read operations issued to the disk per second.	psec
	system_linux_disk_readThroughput	System Linux Disk ReadThroughput	KBps	Monitors the rate of data read from the disk per second.
	system_linux_disk_averageReadWaitTime	System Linux Disk AverageReadWaitTime	microsec	Monitors the average wait time for read requests.
	system_linux_disk_averageRequestWaitTime	System Linux Disk AverageRequestWaitTime	microsec	Monitors the time a disk operation (read and write) waits in the I/O queue before being processed.
	system_linux_disk_writeOperationsRate	System Linux Disk WriteOperationsRate	psec	Monitors the rate of write operations issued to the disk per second.
	system_linux_disk_writeThroughput	System Linux Disk WriteThroughput	KBps	Monitors the rate of data written to the disk per second.
	system_linux_disk_averageWriteWaitTime	System Linux Disk AverageWriteWaitTime	microsec	Monitors the average wait time for write requests.
Agent G2 - Linux OS Resource Parameters - v2	system_linux_openFileDescriptors_Utilization	System Linux OpenFileDescriptors Utilization	%	Linux Open File Descriptors Used Percentage
	system_linux_openFileDescriptors_UsedCount	System Linux OpenFileDescriptors Used Count	count	Current number of Open File Descriptors
	system_linux_loggedInUsers_Pct	System Linux Logged In Users Pct	%	Current number of logged in users percentage
	system_linux_loggedInUsers_Count	System Linux LoggedInUsers Count	count	Current number of logged in users
	system_linux_runningProcesses_Pct	System Linux Running Processes Pct	%	Current running processes percentage
	system_linux_runningProcesses_Count	System Linux RunningProcesses Count	count	Current number of running processes
	system_linux_Semaphores_Utilization	System Linux Semaphores Utilization	%	Semaphore arrays or sets used percentage
	system_linux_Semaphores_UsedCount	System Linux Semaphores Used Count	count	Current number of semaphore arrays in use
	system_linux_messageQueueIDs_Utilization	System Linux MessageQueueIDs Utilization	%	Used percentage of current message queue ID's
	system_linux_messageQueueIDs_UsedCount	System Linux MessageQueueIDs Used Count	count	Current number of message queue ID?s in use
	system_linux_sharedMemoryIDs_Utilization	System Linux SharedMemoryIDs Utilization	%	Used percentage of shared memory ID's
	system_linux_sharedMemoryIDs_UsedCount	System Linux SharedMemoryIDs Used Count	count	Current number of shared memory ID?s in use
	system_linux_createdProcessesPerSec	System Linux CreatedProcesses PerSec	Count per sec	Provides the count of processes created or managed per second on the Linux system since the system was rebooted.
	system_linux_pageFaultsPerSec	System Linux PageFaults PerSec	Count per sec	Monitors the count of page faults per second on the Linux system.
	system_linux_kernelContextSwitchesPerSec	System Linux KernelContextSwitches PerSec	Count per sec	Monitors the count of context switches per second on the Linux system.

Agent G2 - Linux Process Statistics Monitoring

Description

Monitors the process statistics of given process list. Should give process list in configuration parameter - custom arguments param

Prerequisites

NULL

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux Process Statistics Monitor	system.process.stats.cpu	System Process Stats Cpu Usage	%	Monitors Cpu Usage of each process of Linux Device.
	system.process.stats.count	System Process Stats Instance Count	count	Monitors Instance count of each process of Linux Device.
	system.process.stats.threads	System Process Stats Thread Count	count	Monitors thread count of each process of Linux Device.
	system.process.stats.open.fds	System Process Stats Open Fd count	count	Monitors open fd count of each process of Linux Device.
	system.process.stats.memory	System Process Stats Memory Usage	%	Monitors Memory Usage of each process of Linux Device.

Agent G2 - Linux Process Statistics Monitoring - v2

Description

Agent G2 - Linux Process Statistics Monitoring - v2

Prerequisites

NULL

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux Process Statistics Monitor -v2	system.process.stats.cpu	System Process Stats Cpu Usage	%	Monitors Cpu Usage of each process of Linux Device.
	system.process.stats.count	System Process Stats Instance Count	count	Monitors Instance count of each process of Linux Device.
	system.process.stats.threads	System Process Stats Thread Count	count	Monitors thread count of each process of Linux Device.
	system.process.stats.open.fds	System Process Stats Open Fd count	count	Monitors open fd count of each process of Linux Device.
	system.process.stats.memory	System Process Stats Memory Usage	%	Monitors Memory Usage of each process of Linux Device.

Agent G2 - Linux Veritas Cluster Monitoring

Description

Template to monitor veritas Linux cluster parameters like cluster node state, service group state, resource state, service group failover status and this template need to assigned on all cluster nodes. This template tested with two node veritas Linux cluster (version - “Veritas_InfoScale_7.3.1”) running on CentOS7.

Prerequisites

NULL

Monitor Name	Metric Name	Metric Display Name	Unit	Description
G2 - Linux Veritas Cluster Monitor	system_linux_veritas_cluster_resource_state	System Linux Veritas Cluster Resource State		System Linux Veritas Cluster Resource State - Below are the possible states of the resource: OFFLINE:0 ONLINE:1 FAULTED:2 PARTIAL:3 STARTING:4 STOPPING:5 MIGRATING:6 OFFLINE\|FAULTED:7 OFFLINE\|STARTING:8 PARTIAL\|FAULTED:9 PARTIAL\|STARTING:10 PARTIAL\|STOPPING:11 ONLINE\|STOPPING:12
	system_linux_veritas_cluster_group_online_status	System Linux Veritas Cluster Group Online Status		System Linux Veritas Cluster Group Online Status - Below are the possible values : 0 - Service group online on cluster node. 1 - Service group not online on any cluster node.
	system_linux_veritas_cluster_resource_online_status	System Linux Veritas Cluster Resource Online Status		System Linux Veritas Cluster Resource Online Status . Below are the possible values: 0 - Resource state in online on any cluster node, 1 - Resource state is not online on any cluster node
	system_linux_veritas_cluster_node_state	System Linux Veritas Cluster Node State		System Linux Veritas Cluster Node State - Below are the possible states: RUNNING : 0 ADMIN_WAIT : 1 CURRENT_DISCOVER_WAIT : 2 CURRENT_PEER_WAIT : 3 EXITING : 4 EXITED : 5 EXITING_FORCIBLY : 6 FAULTED : 7 INITING : 8 LEAVING : 9 LOCAL_BUILD : 10 REMOTE_BUILD : 11 STALE_ADMIN_WAIT : 12 STALE_DISCOVER_WAIT : 13 STALE_PEER_WAIT : 14 UNKNOWN : 15
	system_linux_veritas_cluster_group_state	System Linux Veritas Cluster Group State		System Linux Veritas Cluster Group State - Below are the possible values : OFFLINE\t: 0 ONLINE\t: 1 FAULTED : 2 PARTIAL : 3 STARTING : 4 STOPPING : 5 MIGRATING : 6 OFFLINE\|FAULTED : 7 OFFLINE\|STARTING : 8 PARTIAL\|FAULTED : 9 PARTIAL\|STARTING : 10 PARTIAL\|STOPPING : 11 ONLINE\|STOPPING : 12
	G2 - Linux Veritas Cluster Group Failover Monitor	system_linux_veritas_cluster_group_failover_status	System Linux Veritas Cluster Group Failover Status		System Linux Veritas Cluster Group Failover Status - Below are the possible values: 0 - No change. 1 - Cluster group change from one node to another due to failover. 2 - The specific cluster group is not online on any cluster node.

Agent G2 - Logfile Monitoring

Description

The Logfile monitor is used to validate whether the given input string is found or not in the specified input logfile. It sends an alert based on the check type (yes or no), and regex patterns are also allowed in the input string. We have added support for alert tokens in G2 logfile monitoring. In the global template, we have included all tokens, and customers can choose the required tokens based on their requirements.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 Logfile Monitor	system_logfile_search_monitor	system_logfile_search_monitor		Using logfile monitor to validate given input string is found or not by from given input logfile and sends the alerts

Agent G2 - Microsoft Active Directory 2003 - Performance Counters

Description

Template for AD 2003 Servers.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Active Directory 2003 - Performance Counters	DSServerBindsPersec	DSServerBindsPersec		Shows the number of DC-to-DC binds per second that are serviced by this DC.
	LDAPClientSessions	LDAPClientSessions		The number of sessions of connected LDAP clients. Lack of activity points to network problems.
	DRAOutboundObjectsPersec	DRAOutboundObjectsPersec		The number of objects sent (per second) through outbound replication to replication partners.
	ABClientSessions	ABClientSessions		AB Client Sessions is the number of connected Address Book client sessions.
	DRAInboundObjectsPersec	DRAInboundObjectsPersec		The number of objects received (per second) through inbound replication from replication partners.
	DRAInboundObjectsAppliedPersec	DRAInboundObjectsAppliedPersec		This counter excludes changes that are received but not applied (for example, when the update is already made) and also how many replication updates are occurring on the server as a result of changes generated on other servers.
	KerberosAuthentications	KerberosAuthentications		The number of times per second that clients use a client ticket to this domain controller to authenticate to this domain controller. A lack of activity can indicate network problems that are preventing authentication requests from succeeding.
	DRAInboundObjectUpdatesRemaininginPacket	DRAInboundObjectUpdatesRemaininginPacket		This counter tells you whether the monitored server is receiving changes, but is taking a long time applying them to the database. The value should be low, with a higher value indicating that the hardware is incapable of adequately servicing replication (warranting a server upgrade).
	NTLMAuthentications	NTLMAuthentications		The number of NTLM authentications (per second) serviced by this domain controller
	LDAPSearchesPersec	LDAPSearchesPersec		The number of search operations per second performed by LDAP clients. A lack of activity points to network problems.
	DSDirectoryReadsPersec	DSDirectoryReadsPersec		Shows the number of directory reads per second.
	DSDirectoryWritesPersec	DSDirectoryWritesPersec		Shows the number of directory writes per second.
	LDAPActiveThreads	LDAPActiveThreads		LDAP Active Threads is the current number of threads in use by the LDAP subsystem of the local direcotry service.
	LDAPWritesPersec	LDAPWritesPersec		Shows the rate at which LDAP clients perform write operations.
	DRAOutboundBytesTotalPersec	DRAOutboundBytesTotalPersec	Bytes per second	It is the sum of the number of bytes of uncompressed data (never compressed) and compressed data (after compression) sent per second. Lack of activity indicates that the hardware or network is slowing down replication.
	DSNotifyQueueSize	DSNotifyQueueSize		The number of pending update notifications that have been queued, but not yet transmitted to clients.
	DRAInboundBytesTotalPersec	DRAInboundBytesTotalPersec	Bytes per second	It is the sum of the number of bytes (per second) of uncompressed data (never compressed) and compressed data (after compression) received through replication. Lack of activity indicates that the network is slowing down replication.
	LDAPUDPoperationsPersec	LDAPUDPoperationsPersec		Shows the number of UDP operations that the LDAP server is processing per second.
	LDAPBindTime	LDAPBindTime	Milliseconds	This counter shows the time required for completion of the last LDAP binding, with a higher value pointing to either hardware or network performance problems.
	DSClientBindsPersec	DSClientBindsPersec		Shows the number of Ntdsapi.dll binds per second serviced by this DC.
	DRAPendingReplicationSynchronizations	DRAPendingReplicationSynchronizations		The number of directory synchronizations that are queued for this server that are not yet processed. This counter helps in determining replication backlog - the larger the number, the larger the backlog. This value should be low, with a higher value indicating that the hardware is not adequately servicing replication.

Agent G2 - Microsoft Active Directory 2008 - Performance Counters

Description

Template for AD 2008 Servers.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Active Directory 2008 - Performance Counters	LDAPWritesPersec	LDAPWritesPersec		Shows the rate at which LDAP clients perform write operations.
	NTLMAuthentications	NTLMAuthentications		The number of NTLM authentications (per second) serviced by this domain controller
	LDAPClientSessions	LDAPClientSessions		The number of sessions of connected LDAP clients. Lack of activity points to network problems.
	ABClientSessions	ABClientSessions		AB Client Sessions is the number of connected Address Book client sessions.
	DSClientBindsPersec	DSClientBindsPersec		Shows the number of Ntdsapi.dll binds per second serviced by this DC.
	LDAPActiveThreads	LDAPActiveThreads		LDAP Active Threads is the current number of threads in use by the LDAP subsystem of the local directory service.
	LDAPUDPoperationsPersec	LDAPUDPoperationsPersec		Shows the number of UDP operations that the LDAP server is processing per second.
	LDAPBindTime	LDAPBindTime	Milliseconds	This counter shows the time required for completion of the last LDAP binding, with a higher value pointing to either hardware or network performance problems.
	DRAOutboundObjectsPersec	DRAOutboundObjectsPersec		The number of objects sent (per second) through outbound replication to replication partners.
	DRAInboundObjectsPersec	DRAInboundObjectsPersec		The number of objects received (per second) through inbound replication from replication partners.
	DRAPendingReplicationSynchronizations	DRAPendingReplicationSynchronizations		The number of directory synchronizations that are queued for this server that are not yet processed. This counter helps in determining replication backlog - the larger the number, the larger the backlog. This value should be low, with a higher value indicating that the hardware is not adequately servicing replication.
	DSNotifyQueueSize	DSNotifyQueueSize		The number of pending update notifications that have been queued, but not yet transmitted to clients.
	DSServerBindsPersec	DSServerBindsPersec		Shows the number of DC-to-DC binds per second that are serviced by this DC.
	DSDirectoryReadsPersec	DSDirectoryReadsPersec		Shows the number of directory reads per second.
	DRAInboundObjectUpdatesRemaininginPacket	DRAInboundObjectUpdatesRemaininginPacket		This counter tells you whether the monitored server is receiving changes, but is taking a long time applying them to the database. The value should be low, with a higher value indicating that the hardware is incapable of adequately servicing replication (warranting a server upgrade).
	KerberosAuthentications	KerberosAuthentications		The number of times per second that clients use a client ticket to this domain controller to authenticate to this domain controller. A lack of activity can indicate network problems that are preventing authentication requests from succeeding.
	DRAInboundObjectsAppliedPersec	DRAInboundObjectsAppliedPersec		This counter excludes changes that are received but not applied (for example, when the update is already made) and also how many replication updates are occurring on the server as a result of changes generated on other servers.
	LDAPSearchesPersec	LDAPSearchesPersec		The number of search operations per second performed by LDAP clients. A lack of activity points to network problems.
	DSDirectoryWritesPersec	DSDirectoryWritesPersec		Shows the number of directory writes per second.
	DRAOutboundBytesTotalPersec	DRAOutboundBytesTotalPersec	Bytes per second	It is the sum of the number of bytes of uncompressed data (never compressed) and compressed data (after compression) sent per second. Lack of activity indicates that the hardware or network is slowing down replication.
	DRAInboundBytesTotalPersec	DRAInboundBytesTotalPersec	Bytes per second	It is the sum of the number of bytes (per second) of uncompressed data (never compressed) and compressed data (after compression) received through replication. Lack of activity indicates that the network is slowing down replication.

Agent G2 - Microsoft Active Directory 2012 DotNet v4 - Performance Counters

Description

Monitors Microsoft Active Directory Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Active Directory 2012 DotNet v4 - Performance Counters	LDAPWritesPersec	LDAPWritesPersec		Shows the rate at which LDAP clients perform write operations.
	DRAOutboundBytesTotalPersec	DRAOutboundBytesTotalPersec	Bytes per second	It is the sum of the number of bytes of uncompressed data (never compressed) and compressed data (after compression) sent per second. Lack of activity indicates that the hardware or network is slowing down replication.
	DSClientBindsPersec	DSClientBindsPersec		Shows the number of Ntdsapi.dll binds per second serviced by this DC.
	LDAPClientSessions	LDAPClientSessions		The number of sessions of connected LDAP clients. Lack of activity points to network problems.
	DRAInboundObjectsPersec	DRAInboundObjectsPersec		The number of objects received (per second) through inbound replication from replication partners.
	DSDirectoryReadsPersec	DSDirectoryReadsPersec		Shows the number of directory reads per second.
	LDAPUDPoperationsPersec	LDAPUDPoperationsPersec		Shows the number of UDP operations that the LDAP server is processing per second.
	LDAPActiveThreads	LDAPActiveThreads		LDAP Active Threads is the current number of threads in use by the LDAP subsystem of the local directory service.
	LDAPSearchesPersec	LDAPSearchesPersec		The number of search operations per second performed by LDAP clients. A lack of activity points to network problems.
	LDAPBindTime	LDAPBindTime	Milliseconds	This counter shows the time required for completion of the last LDAP binding, with a higher value pointing to either hardware or network performance problems.
	DSDirectoryWritesPersec	DSDirectoryWritesPersec		Shows the number of directory writes per second.
	DRAPendingReplicationSynchronizations	DRAPendingReplicationSynchronizations		The number of directory synchronizations that are queued for this server that are not yet processed. This counter helps in determining replication backlog - the larger the number, the larger the backlog. This value should be low, with a higher value indicating that the hardware is not adequately servicing replication.
	ABClientSessions	ABClientSessions		AB Client Sessions is the number of connected Address Book client sessions.
	DSServerBindsPersec	DSServerBindsPersec		Shows the number of DC-to-DC binds per second that are serviced by this DC.
	DRAInboundBytesTotalPersec	DRAInboundBytesTotalPersec	Bytes per second	It is the sum of the number of bytes (per second) of uncompressed data (never compressed) and compressed data (after compression) received through replication. Lack of activity indicates that the network is slowing down replication.
	DSNotifyQueueSize	DSNotifyQueueSize		The number of pending update notifications that have been queued, but not yet transmitted to clients.
	DRAInboundObjectsAppliedPersec	DRAInboundObjectsAppliedPersec		This counter excludes changes that are received but not applied (for example, when the update is already made) and also how many replication updates are occurring on the server as a result of changes generated on other servers.
	DRAInboundObjectUpdatesRemaininginPacket	DRAInboundObjectUpdatesRemaininginPacket		This counter tells you whether the monitored server is receiving changes, but is taking a long time applying them to the database. The value should be low, with a higher value indicating that the hardware is incapable of adequately servicing replication (warranting a server upgrade).
	DRAOutboundObjectsPersec	DRAOutboundObjectsPersec		The number of objects sent (per second) through outbound replication to replication partners.

Agent G2 - Microsoft Active Directory 2019 DotNet v4- Performance Counters

Description

Monitors Microsoft Active Directory Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Active Directory 2019 DotNet v4- Performance Counters	DSNotifyQueueSize	DSNotifyQueueSize		The number of pending update notifications that have been queued, but not yet transmitted to clients.
	DSServerBindsPersec	DSServerBindsPersec		Shows the number of DC-to-DC binds per second that are serviced by this DC.
	DRAOutboundBytesTotalPersec	DRAOutboundBytesTotalPersec	Bytes per second	It is the sum of the number of bytes of uncompressed data (never compressed) and compressed data (after compression) sent per second. Lack of activity indicates that the hardware or network is slowing down replication.
	DRAPendingReplicationSynchronizations	DRAPendingReplicationSynchronizations		The number of directory synchronizations that are queued for this server that are not yet processed. This counter helps in determining replication backlog - the larger the number, the larger the backlog. This value should be low, with a higher value indicating that the hardware is not adequately servicing replication.
	DRAInboundObjectsAppliedPersec	DRAInboundObjectsAppliedPersec		This counter excludes changes that are received but not applied (for example, when the update is already made) and also how many replication updates are occurring on the server as a result of changes generated on other servers.
	DSDirectoryWritesPersec	DSDirectoryWritesPersec		Shows the number of directory writes per second.
	DRAInboundBytesTotalPersec	DRAInboundBytesTotalPersec	Bytes per second	It is the sum of the number of bytes (per second) of uncompressed data (never compressed) and compressed data (after compression) received through replication. Lack of activity indicates that the network is slowing down replication.
	DSDirectoryReadsPersec	DSDirectoryReadsPersec		Shows the number of directory reads per second.
	LDAPBindTime	LDAPBindTime	Milliseconds	This counter shows the time required for completion of the last LDAP binding, with a higher value pointing to either hardware or network performance problems.
	LDAPClientSessions	LDAPClientSessions		The number of sessions of connected LDAP clients. Lack of activity points to network problems.
	DRAOutboundObjectsPersec	DRAOutboundObjectsPersec		The number of objects sent (per second) through outbound replication to replication partners.
	LDAPWritesPersec	LDAPWritesPersec		Shows the rate at which LDAP clients perform write operations.
	DRAInboundObjectUpdatesRemaininginPacket	DRAInboundObjectUpdatesRemaininginPacket		This counter tells you whether the monitored server is receiving changes, but is taking a long time applying them to the database. The value should be low, with a higher value indicating that the hardware is incapable of adequately servicing replication (warranting a server upgrade).
	LDAPSearchesPersec	LDAPSearchesPersec		The number of search operations per second performed by LDAP clients. A lack of activity points to network problems.
	ABClientSessions	ABClientSessions		AB Client Sessions is the number of connected Address Book client sessions.
	DSClientBindsPersec	DSClientBindsPersec		Shows the number of Ntdsapi.dll binds per second serviced by this DC.
	LDAPActiveThreads	LDAPActiveThreads		LDAP Active Threads is the current number of threads in use by the LDAP subsystem of the local directory service.
	DRAInboundObjectsPersec	DRAInboundObjectsPersec		The number of objects received (per second) through inbound replication from replication partners.
	LDAPUDPoperationsPersec	LDAPUDPoperationsPersec		Shows the number of UDP operations that the LDAP server is processing per second.

Agent G2 - Microsoft DotNet Performance Counters DotNet v4

Description

Monitors Microsoft DotNet Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft DotNet Performance Counters DotNet v4	netclr.numberof.current.physicalthreads	NETCLR Number of Current Physical Threads		Shows the number of native OS threads created and owned by the CLR to act as underlying threads for .NET thread objects. This counter's value does not include the threads used by the CLR in its internal operations; it is a subset of the threads in the OS process.
	aspnet.requests.current	ASPNET Requests Current		Shows the current number of requests, including those that are queued, currently executing, or waiting to be written to the client. Under the ASP.NET process model, when this counter exceeds the requestQueueLimit defined in the processModel configuration section, ASP.NET will begin rejecting requests.
	aspnet.request.wait.time	ASPNET Request Wait Time	MS	Shows the number of milliseconds the most recent request was waiting in the queue.
	netclr.current.queue.length	NETCLR Current Queue Length		Shows the total number of threads currently waiting to acquire some managed lock in the application. This counter is not an average over time; it displays the last observed value.
	netclr.numberofexceps.thrown.persec	NETCLR Number of Exceps Thrown Per sec		Shows the number of exceptions thrown per second. These include both .NET exceptions and unmanaged exceptions that get converted into .NET exceptions e.g. null pointer reference exception in unmanaged code would get re-thrown in managed code as a .NET System.NullReferenceException; this counter includes both handled and unhandled exceptions.
	webservice.get.requests.persec	Web Service Get Requests Per sec		Shows the rate HTTP requests using the GET method are made. Get requests are the most common HTTP request.
	netclr.numberof.current.logicalthreads	NETCLR Number of Current Logical Threads		Shows the number of current .NET thread objects in the application. A .NET thread object is created either by new System.Threading.Thread or when an unmanaged thread enters the managed environment. This counter maintains the count of both running and stopped threads. This counter is not an average over time; it just displays the last observed value.
	webservice.current.connections	Web Service Current Connections		Shows the current number of connections established with the Web service.
	netclr.contention.rate.persec	NETCLR Contention Rate Per sec		Rate at which threads in the runtime attempt to acquire a managed lock unsuccessfully. Managed locks can be acquired in many ways; by the "lock" statement in C# or by calling System.Monitor. Enter or by using MethodImplOptions.Synchronized custom attribute.
	webservice.post.requests.persec	Web Service Post Requests Per sec		Shows the rate HTTP requests using the POST method are made.

Agent G2 - Microsoft Exchange 2007 - Server Role - Client Access Servers (CAS) DotNet v4

Description

Applicable on Exchange Servers with the CAS role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Description
Agent G2 - Microsoft Exchange 2007 - Server Role - Client Access Servers DotNet v4	SyncCommandsPersec	Sync Commands Per sec	Sync Commands/sec is the number of Sync commands that are processed per second. Clients use this command to synchronize items within a folder.
	DownloadTasksCompleted	Download Tasks Completed	Download Tasks Completed is the number of OAB download tasks completed.
	OWARequestsPersec	OWA Requests Per sec	Requests/sec is the number of requests handled by Outlook Web App per second.
	DownloadTaskQueued	Download Task Queued	Download Task Queued is one(1) if task is queued for execution, otherwise zero(0).
	AverageSearchTime	Average Search Time	Average Search Time is the average time that elapsed while waiting for a search to complete.
	CurrentConnections	Current Connections	The number of active connections to the WWW service.
	AverageTimetoProcessaFreeBusyRequest	Average Time to Process a Free Busy Request	Average Time to Process a Free Busy Request is the average time to process a free busy request in seconds. One request may contain multiple mailboxes. Free busy responses do not have meeting suggestions.
	AverageResponseTime	Average Response Time	Average Response Time is the average time (in milliseconds) that elapsed between the beginning and end of an OEH or ASPX request.
	ActiveSyncRequestsPersec	ActiveSync Requests Per sec	Shows the number of HTTP requests that are received from the client via ASP.NET per second.
	AvailabilityRequestssec	Availability Requests per sec	Availability Requests per second is the number of requests serviced per second. The request can be only for free busy or include suggestions. One request may contain multiple mailboxes.

Agent G2 - Microsoft Exchange 2007 - Server Role - Client Access Servers ASPNET (CAS ASPNET) DotNet v4

Description

Applicable on Exchange Servers with CAS ASPNET role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Description
Agent G2 - Microsoft Exchange 2007 - Server Role - Client Access Servers ASPNET DotNet v4	RequestWaitTime	Request Wait Time	RPC Requests outstanding is the current number of outstanding RPC requests.
	WorkerProcessRestarts	Worker Process Restarts	Number of times a worker process has restarted on the machine.
	RequestsCurrent	Requests Current	The current number of requests both executing and queued.
	ApplicationRestarts	Application Restarts	Number of times the application has been restarted during the web server lifetime.
	RequestsInApplicationQueue	Requests In Application Queue	The current number of requests, including those that are queued, currently executing, or waiting to be written to the client. Under the ASP.NET process model, when this counter exceeds the requestQueueLimit defined in the processModel configuration section, ASP.NET will begin rejecting requests.

Agent G2 - Microsoft Exchange 2007 - Server Role - Edge Transport Server (ETS) DotNet v4

Description

Applicable on Exchange Servers with the ETS role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2007 - Server Role - Edge Transport Server DotNet v4	LogThreadsWaiting	Log Threads Waiting		Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of threads waiting for their data to be written to the log to complete an update of the database. If this number is too high, the log may be a bottleneck. This value should be less than 10 on average. Regular spikes concurrent with log record stall spikes indicate that the transaction log disks are a bottleneck. If the value for log threads waiting is more than the spindles available for the logs, there is a bottleneck on the log disks.
	IODatabaseReadsPersec	IO Database Reads Per sec		I/O Database Reads/sec is the rate of database read operations completed.
	RetryRemoteDeliveryQueueLength	Retry Remote Delivery Queue Length		Retry Remote Delivery Queue Length is the number of messages in retry in the remote delivery queues.
	SubmissionQueueLength	Submission Queue Length		The number of items in the submission queue when sample was taken.
	LargestDeliveryQueueLength	Largest Delivery Queue Length		The number of items in the largest delivery queue.
	AggregateDeliveryQueueLengthAllQueues	Aggregate Delivery Queue Length All Queues		The number of messages queued for aggregate delivery.
	Versionbucketsallocated	Version Buckets Allocated		It provides the total number of version buckets allocated.
	ActiveRemoteDeliveryQueueLength	Active Remote Delivery Queue Length		The number of messages queued for remote delivery.
	LogRecordStallsPersec	Log Record Stalls Per sec		Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of log records that cannot be added to the log buffers per second because the log buffers are full. If this counter is non-zero most of the time, the log buffer size may be a bottleneck. If I/O log write latencies are high, check for RAID5 or sync replication on log devices. The average value should be below 10 per second. Spikes (maximum values) should not be higher than 100 per second.
	PoisonQueueLength	Poison Queue Length		The number of messages in the poison message queue.
	IODatabaseWritesPersec	IO Database Writes Per sec		I/O Database Writes/sec is the rate of database write operations completed.
	DatabaseCachePercentHit	Database Cache Percent Hit	%	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the percentage of database file page requests that were fulfilled by the database cache without causing a file operation. If this percentage is too low, the database cache size may be too small. This value should be over 90% for companies with majority online mode clients. It should be over 99% for companies with majority cached mode clients. If the hit ratio is less than these numbers, the database cache may be insufficient.
	UnreachableQueueLength	Unreachable Queue Length		The number of messages in Unreachable Queue when sample was taken.

Agent G2 - Microsoft Exchange 2007 - Server Role - HUB Transport Servers (HTS) DotNet v4

Description

Applicable on Exchange Servers with the HTS role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Description
Agent G2 - Microsoft Exchange 2007 - Server Role - HUB Transport Servers DotNet v4	ActiveNonSmtpDeliveryQueueLength	Active Non-SMTP Delivery Queue Length	The number of messages queued for delivery to a Non-SMTP transport. The value format is a 4-byte integer.
	RetryNonSmtpDeliveryQueueLength	Retry Non-SMTP Delivery Queue Length	Assures the number of messages currently in the retry non-SMTP delivery queue. Messages in this queue are in a retry state because an issue prevented their delivery. If the issue is transient, a subsequent reattempt to send the message may be successful. A queue length < 200 can be considered as Ok.
	ActiveMailboxDeliveryQueueLength	Active Mailbox Delivery Queue Length	The number of messages queued for delivery to an active mailbox. The value format is a 4-byte integer.
	MessagesCompletedDeliveryPerSecond	Messages Completed Delivery Per Second	This monitor is useful in assessing the efficiency and efficacy of the current design. They also provide insight into the interaction between different transport components, including the information store interface. It shows the number of messages that are delivered per second.
	RetryMailboxDeliveryQueueLength	Retry Mailbox Delivery Queue Length	Measures the number of messages currently in the retry mailbox delivery queue. Messages in this queue are in a retry state because an issue prevented their delivery. If the issue is transient, a subsequent attempt to send the message may be successful. A queue length < 200 can be considered as OK.
	MessagesQueuedforDeliveryPerSecond	Messages Queued for Delivery Per Second	This monitor is useful in assessing the efficiency and efficacy of the current design. They also provide insight into the interaction between different transport components, including the information store interface. It shows the number of messages that have been queued for delivery per second.
	MessagesSubmittedPerSecond	Messages Submitted Per Second	This monitor is useful in assessing the efficiency and efficacy of the current design. They also provide insight into the interaction between different transport components, including the information store interface. It shows the number of messages that have been queued in the Submission queue per second.
	SubmissionQueueLength	Submission Queue Length	The number of items in the submission queue when the sample was taken.
	IODatabaseWritesPersec	IO Database Writes Per sec	I/O Database Writes/sec is the rate of database write operations completed.
	MessagesQueuedforDeliveryPerSecond	Messages Queued for Delivery Per Second	This monitor is useful in assessing the efficiency and efficacy of the current design. They also provide insight into the interaction between different transport components, including the information store interface. It shows the number of messages that have been queued for delivery per second.
	LogRecordStallsPersec	Log Record Stalls Per sec	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of log records that cannot be added to the log buffers per second because the log buffers are full. If this counter is non-zero most of the time, the log buffer size may be a bottleneck. If I/O log write latencies are high, check for RAID5 or sync replication on log devices. The average value should be below 10 per second. Spikes (maximum values) should not be higher than 100 per second.
	AggregateDeliveryQueueLengthAllQueues	Aggregate Delivery Queue Length All Queues	The number of messages queued for aggregate delivery.
	IODatabaseReadsPersec	IO Database Reads Per sec	I/O Database Reads/sec is the rate of database read operations completed.
	PoisonQueueLength	Poison Queue Length	The number of messages in the poison message queue.
	LargestDeliveryQueueLength	Largest Delivery Queue Length	The number of items in the largest delivery queue.
	LogThreadsWaiting	Log Threads Waiting	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of threads waiting for their data to be written to the log to complete an update of the database. If this number is too high, the log may be a bottleneck. This value should be less than 10 on average. Regular spikes concurrent with log record stall spikes indicate that the transaction log disks are a bottleneck. If the value for log threads waiting is more than the spindles available for the logs, there is a bottleneck on the log disks.
	ActiveRemoteDeliveryQueueLength	Active Remote Delivery Queue Length	The number of messages queued for remote delivery.
	UnreachableQueueLength	Unreachable Queue Length	The number of messages in Unreachable Queue when the sample was taken.

Agent G2 - Microsoft Exchange 2007 - Server Role - Mailbox Servers (MBS) DotNet v4

Description

Applicable on Exchange Servers with the MBS role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2007 - Server Role - Mailbox Servers DotNet v4	IODatabaseWritesAverageLatency	IO Database Writes Average Latency		Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the average length of time, in milliseconds, per database write operation.
	DatabaseCachePercentHit	Database Cache Percent Hit	%	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the percentage of database file page requests that were fulfilled by the database cache without causing a file operation. If this percentage is too low, the database cache size may be too small. This value should be over 90% for companies with a majority online mode clients. It should be over 99% for companies with majority cached mode clients. If the hit ratio is less than these numbers, the database cache may be insufficient.
	RPCLatencyaveragemsec	RPC Latency Average msec		Exchange communicates with Hub Transport servers via RPC. This counter is useful in isolating and determining issues involving the interface between the Microsoft Exchange Information Store service on the Mailbox server and Hub Transport servers. This monitor shows the average latency, in milliseconds, of RPC requests. The average is calculated over all RPCs since exrpc32 was loaded. The value should be less than 100 ms at all times.
	MessagesDeliveredPersec	Messages Delivered Per sec		Exchange responds to client requests and attempts to fulfill them as quickly and efficiently as possible. This monitor shows the rate that messages are delivered to all recipients. It indicates the current message delivery rate to the store.
	MessagesQueuedForSubmissionISMailbox	Messages Queued For Submission IS Mailbox		Mailbox servers depend on Hub Transport servers for message delivery. This monitor shows the current number of submitted messages that are not yet processed by the transport layer. This value should be below 50 at all times. A higher value for more than 15 minutes may indicate that there are connectivity issues to the transport servers or that backpressure is occurring.
	DirectoryAccessLDAPReadsPersec	Directory Access LDAP Reads Per sec		Exchange responds to client requests and attempts to fulfill them as quickly and efficiently as possible. This monitor shows the current rate that the Lightweight Directory Access Protocol (LDAP) reads occur while processing requests for the client.
	IODatabaseReadsAverageLatency	IO Database Reads Average Latency		Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the average length of time, in milliseconds, per database read operation.
	RPCClientBackoffPersec	RPC Client Backoff Per sec		Exchange throttles RPC clients to prevent individual clients from overusing server resources. This monitor shows the rate that the server notifies the client to back off. It indicates the rate at which client backoffs are occurring. Higher values may indicate that the server may be incurring a higher load resulting in an increase in overall averaged RPC latencies, causing client throttling to occur. This can also occur when certain client user actions are being performed. Depending on what the client is doing and the rate at which RPC operations are occurring, it may be normal to see backoffs occurring.
	RPCNumofSlowPackets	RPC Number of Slow Packets		When you use Microsoft Office Outlook in MAPI mode, Outlook executes client operations as RPCs between the client and the server. This monitor indicates the number of RPC packets in the past 1,024 packets that have latencies longer than 2 seconds. This value should be less than 1 on average, and should be less than 3 at all times.
	ClientRPCsFailedServerTooBusyPersec	Client RPCs Failed Server Too Busy Per sec		Exchange throttles RPC clients to prevent individual clients from overusing server resources. This monitor shows the client-reported rate of failed RPCs (since the store was started) due to the Server Too Busy ROC error. This value should be 0 at all times. Higher values may indicate RPC threads are exhausted or client throttling is occurring for clients running versions of Outlook earlier than Microsoft Office Outlook 2007.
	DirectoryAccessLDAPSearchesPersec	Directory Access LDAP Searches Per sec		Exchange responds to client requests and attempts to fulfill them as quickly and efficiently as possible. This monitor shows the current rate that the LDAP searches occur while processing requests for the client.
	LogRecordStallsPersec	Log Record Stalls Per sec		Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of log records that cannot be added to the log buffers per second because the log buffers are full. If this counter is non-zero most of the time, the log buffer size may be a bottleneck. If I/O log write latencies are high, check for RAID5 or sync replication on log devices. The average value should be below 10 per second. Spikes (maximum values) should not be higher than 100 per second.
	ReplicationReceiveQueueSize	Replication Receive Queue Size		This monitor shows the number of replication messages waiting to be processed. This value should be less than 100 at all times. This value should return to a minimum value between replication intervals.
	MessagesQueuedForSubmissionISPublic	Messages Queued For Submission IS Public		Mailbox servers depend on Hub Transport servers for message delivery. This monitor shows the current number of submitted messages that are not yet processed by the transport layer. This value should be below 20 at all times.
	UserCount	User Count		This monitor shows the number of users connected to the information store. It can be used to determine the current user load.
	DatabaseCacheSizeMB	Database Cache Size MB		Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the amount of system memory, in megabytes, used by the database cache manager to hold commonly used information from the database files to prevent file operations. If the database cache size seems too small for optimal performance and there is little available memory on the system (check the value of Memory/Available Bytes), adding more memory to the system may increase performance. If there is ample memory on the system and the database cache size is not growing beyond a certain point, the database cache size may be capped at an artificially low limit. Increasing this limit may increase performance.
	RPCRequestsoutstanding	RPC Requests outstanding		RPC Requests outstanding is the current number of outstanding RPC requests.
	RPCAveragedLatency	RPC Averaged Latency	Milliseconds	When you use Microsoft Office Outlook in MAPI mode, Outlook executes client operations as RPCs between the client and the server. This monitor indicates the RPC latency, in milliseconds, averaged for all operations in the last 1,024 packets. This value should not be higher than 25 ms on average. To determine if certain protocols are causing overall RPC latencies, monitor MSExchangeIS Client (*)RPC Average Latency to separate latencies based on client protocol. Cross-reference MSExchangeISRPC Client Backoff/sec to ensure higher latencies are not causing client throttling.
	RPCRequests	RPC Requests		RPC Operations/sec is the rate at which RPC operations occur.
	RPCOperationsPersec	RPC Operations Per sec		When you use Microsoft Office Outlook in MAPI mode, Outlook executes client operations as RPCs between the client and the server. This monitor indicates the current number of RPC operations that are occurring per second. Should closely correspond to historical baselines. Values much higher than expected indicate that the workload has changed, while values much lower than expected indicate a bottleneck preventing client requests from reaching the server.
	LogThreadsWaiting	Log Threads Waiting		Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of threads waiting for their data to be written to the log to complete an update of the database. If this number is too high, the log may be a bottleneck. This value should be less than 10 on average. Regular spikes concurrent with log record stall spikes indicate that the transaction log disks are a bottleneck. If the value for log threads waiting is more than the spindles available for the logs, there is a bottleneck on the log disks.
	DatabasePageFaultStallsPersec	Database Page Fault Stalls Per sec		Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the rate that database file page requests require of the database cache manager to allocate a new page from the database cache. This should be 0 at all times. If this value is non-zero, this indicates that the database is not able to flush dirty pages to the database file fast enough to make pages free for new page allocations.

Agent G2 - Microsoft Exchange 2007 - Server Role - Mailbox Servers replication (MBSR) DotNet v4

Description

Applicable on Exchange Servers with the MBSR role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2007 - Server Role - Mailbox Servers replication DotNet v4	ReplayQueueLength	Replay Queue Length		This monitor indicates issues involving the replication engine and replication partners. These issues can be local or remote. This monitor shows the number of transaction log files waiting to be replayed into the passive copy. It indicates the current replay queue length. Higher values cause longer store mount times when a handoff, failover, or activation is performed.
	CopyQueueLength	Copy Queue Length		This monitor indicates issues involving the replication engine and replication partners. These issues can be local or remote. This monitor shows the number of transaction log files waiting to be copied to the passive copy log file folder. A copy is not considered complete until it has been checked for corruption. This value should be less than 10 at all times for Continuous Cluster Replication(CCR). It should be less than 1 at all times for local continuous replication (LCR).

Agent G2 - Microsoft Exchange 2007 - Server Role - Unified Messaging servers (UMS) DotNet v4

Description

Applicable on Exchange Servers with the UMS role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2007 - Server Role - Unified Messaging servers DotNet v4	OperationsoverSixSeconds	OperationsoverSixSeconds	NULL	Shows the number of all Unified Messaging operations that took more than six seconds to complete. This is the time during which a caller was waiting for Unified Messaging to respond.
	MailboxServerAccessFailures	MailboxServerAccessFailures	NULL	Shows the number of times the system did not access a Mailbox server. This value should be 0 at all times. A non-zero value indicates that Unified Messaging is having problems with MAPI connectivity to mbx servers.
	CallsDisconnectedbyCallersDuringUMAudioHourglass	CallsDisconnectedbyCallersDuringUMAudioHourglass	NULL	Shows the number of calls during which the caller disconnected while Unified Messaging was playing the audio hourglass tones. This value should be 0 at all times. A non-zero value suggests excessive latency between a Unified Messaging server and targeted domain controller.

Agent G2 - Microsoft Exchange 2007 General DotNet v4

Description

Monitors Microsoft Exchange 2007 General Performance Counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2007 General DotNet v4	ConnectionAttemptsPersec	Connection Attempts Per Second		The rate, in seconds, at which connections to the WWW service have been attempted since the service started.
	NumberBytesinallHeaps	Number Bytes in all Heaps		Shows the sum of four other counters: Gen 0 Heap Size, Gen 1 Heap Size, Gen 2 Heap Size, and the Large Object Heap Size. This counter indicates the current memory allocated in bytes on the GC Heaps.
	NumberofExcepsThrownPersec	Number of Exceptions Thrown Per Second		Displays the number of exceptions thrown per second. These include both .NET exceptions and unmanaged exceptions that get converted into .NET exceptions.
	PercentTimeinGC	Percent Time in GC	%	% Time in GC is the percentage of elapsed time that was spent in performing a garbage collection (GC) since the last GC cycle. This counter is usually an indicator of the work done by the Garbage Collector on behalf of the application to collect and compact memory. This counter is updated only at the end of every GC and the counter value reflects the last observed value; its not an average.

Agent G2 - Microsoft Exchange 2010 AD Access DC DotNet v4

Description

Monitor Microsoft Exchange 2010 AD Access DC performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2010 AD Access DC DotNet v4	LDAPReadTime	LDAP Read Time		Shows the time (in ms) to send an LDAP read request and receive a response.
Agent G2 - Microsoft Exchange 2010 AD Access DC DotNet v4	LDAPSearchTime	LDAP Search Time	Milliseconds	Shows the time (in ms) to send an LDAP search request and receive a response. Should be below 50 ms on average. Spikes (maximum values) shouldn't be higher than 100 ms.

Agent G2 - Microsoft Exchange 2010 DotNet v4

Description

Monitor Microsoft Exchange 2010 performance counters

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2010 DotNet v4	ReceiveQueueSizeMailBox	Receive Queue Size Mailbox		Maximum allowed number of messages in the mailbox receive queue.
	LDAPSearchesTimedOut	LDAP Searches Timed Out		LDAP Searches timed out per minute is the number of LDAP searches returned LDAP_TIMEOUT during the last minute.
	RPCAveragedLatency	RPC Averaged Latency	Milliseconds	When you use Microsoft Office Outlook in MAPI mode, Outlook executes client operations as RPCs between the client and the server. This monitor indicates the RPC latency, in milliseconds, averaged for all operations in the last 1,024 packets. This value should not be higher than 25 ms on average. To determine if certain protocols are causing overall RPC latencies, monitor MSExchangeIS Client (*)RPC Average Latency to separate latencies based on client protocol. Cross-reference MSExchangeISRPC Client Backoff/sec to ensure higher latencies are not causing client throttling.
	ActiveNonSmtpDeliveryQueueLength	Active Non-SMTP Delivery Queue Length		The number of messages queued for delivery to a Non-SMTP transport. The value format is a 4-byte integer.
	MessagesQueuedForSubmissionMailBox	Messages Queued For Submission Mailbox		Messages Queued For Submission is the current number of submitted messages which are not yet processed by transport.
	PollingDelay	Polling Delay	Seconds	Polling delay is the latency between when the most recent Mapi Event was polled and when the event was created in seconds.
	LDAPSearchTime	LDAP Search Time	Milliseconds	Shows the time (in ms) to send an LDAP search request and receive a response. Should be below 50 ms on average. Spikes (maximum values) shouldn't be higher than 100 ms.
	ClientLogonsMailBox	Client Logons Mailbox		The number of client logons (including system processes). The average number of logons per client depends on the type and version of the client.
	MessagesSentPersecMailBox	Messages Sent Persec Mailbox		Messages Sent/sec is the rate that messages are sent to the transport.
	Versionbucketsallocated	Version Buckets Allocated		It provides the total number of version buckets allocated.
	SubmissionQueueLength	Submission Queue Length		The number of items in the submission queue when sample was taken.
	AverageDeliveryTimePublicFolder	Average Delivery Time Public Folder	Milliseconds	Average Delivery Time is the average time in milliseconds between the submission of a message to the public store and the delivery to all local recipients (recipients on the same server) for the last 10 messages.
	UnreachableQueueLength	Unreachable Queue Length		The number of messages in Unreachable Queue when sample was taken.
	MessagesDeliveredPersecMailBox	Messages Delivered Persec Mailbox		Messages Delivered/sec is the rate that messages are delivered to all recipients.
	AverageDeliveryTimeMailBox	Average Delivery Time Mailbox	Milliseconds	Average Delivery Time is the average time in milliseconds between the submission of a message to the mailbox store and the delivery to all local recipients (recipients on the same server) for the last 10 messages.
	RPCRequests	RPC Requests		RPC Operations/sec is the rate at which RPC operations occur.
	MessagesDeliveredPersecPublicFolder	Messages Delivered Persec Public Folder		Messages Delivered Persec Public Folder
	ClientLogonsPublicFolder	Client Logons Public Folder		Client Logons is the number of clients (including system processes) currently logged on.
	RetryRemoteDeliveryQueueLength	Retry Remote Delivery Queue Length		Retry Remote Delivery Queue Length is the number of messages in retry in the remote delivery queues.
	LogGenerationCheckpointDepth	Log Generation Checkpoint Depth		Log Generation Checkpoint Depth represents the amount of work, in count of log files, that will need to be redone or undone to the database file(s) if the process crashes.
	LargestDeliveryQueueLength	Largest Delivery Queue Length		The number of items in the largest delivery queue.
	IODatabaseReadsPersec	I/O Database Reads Persec		I/O Database Reads/sec is the rate of database read operations completed.
	ActiveMailboxDeliveryQueueLength	Active Mailbox Delivery Queue Length		The number of messages queued for delivery to an active mailbox. The value format is a 4-byte integer.
	SendQueueSizeMailbox	Send Queue Size Mailbox		Indicates the number of messages in the mailbox store's send queue.
	PercentageofFailedEventDispatchers	Percentage of Failed Event Dispatchers	%	It is the percentage of Event Dispatchers that are in failure mode.
	PoisonQueueLength	Poison Queue Length		The number of messages in the poison message queue.
	LogBytesWritePersec	Log Bytes Write Persec	Bytes per second	Log Bytes Write per second is the rate bytes are written to the log.
	RetryMailboxDeliveryQueueLength	Retry Mailbox Delivery Queue Length		Measures the number of messages currently in the retry mailbox delivery queue. Messages in this queue are in a retry state because an issue prevented their delivery. If the issue is transient, a subsequent attempt to send the message may be successful. A queue length < 200 can be considered as OK.
	SendQueueSizePublicFolder	Send Queue Size Public Folder		Number of messages in a public folders send queue. The value should be less than 500.
	RetryNonSmtpDeliveryQueueLength	Retry Non-SMTP Delivery Queue Length		Assures the number of messages currently in the retry non-SMTP delivery queue. Messages in this queue are in a retry state because an issue prevented their delivery. If the issue is transient, a subsequent reattempt to send the message may be successful. A queue length < 200 can be considered as Ok.
	ReceiveQueueSizePublicFolder	Receive Queue Size Public Folder		Indicates the number of public folder replication messages waiting to be processed.
	MessagesSentPersecPublicFolder	Messages Sent Persec Public Folder		Messages Sent/sec is the rate that messages are sent to the transport.
	MessagesQueuedForSubmissionPublicFolder	Messages Queued For Submission Public Folder		Messages Queued For Submission is the current number of submitted messages which are not yet processed by transport.
	MessageRecipientsDeliveredPersecMailBox	Message Recipients Delivered Persec Mailbox		Shows the rate at which messages are delivered to all recipients. Indicates current message delivery rate to the store.
	AggregateDeliveryQueueLengthAllQueues	Aggregate Delivery Queue Length All Queues		The number of messages queued for aggregate delivery.
	ActiveRemoteDeliveryQueueLength	Active Remote Delivery Queue Length		The number of messages queued for remote delivery.
	ClientRPCsSucceded	Client RPCs Succeeded		The client-reported total number of successful RPCs (since the store was started).
	ClientLatency10secRPC	Client Latency 10 sec RPC	Milliseconds	The client-reported number of successful RPCs with latencies > 10 seconds.
	ActiveClientLogonsPublicFolder	Active Client Logons Public Folder		Active Client Logons is the number of clients that performed any action within the last ten minute time interval.
	IODatabaseWritesPersec	I/O Database Writes Persec		I/O Database Writes/sec is the rate of database write operations completed.
	ActiveClientLogonsMailBox	Active Client Logons Mailbox		The number of logons that have been active within the last ten minute time interval.
	MessageRecipientsDeliveredPersecPublicFolder	Message Recipients Delivered Persec Public Folder		Message Recipients Delivered/sec is the rate that recipients receive messages.
	LongRunningLDAPOperations	Long Running LDAP Operations		Shows the number of LDAP operations on this domain controller that took longer than the specified threshold per minute. (Default threshold is 15 seconds.). Should be less than 50 at all times.

Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Client Access Servers (CAS)

Description

Applicable on Exchange Servers with the Client Access servers (CAS) role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Client Access Servers	DownloadTasksCompleted	Download Tasks Completed	NULL	Download Tasks Completed is the number of OAB download tasks completed
	ActiveSyncRequestsPersec	ActiveSync Requests Per Second	NULL	Shows the number of HTTP requests that are received from the client via ASP.NET per second
	AverageSearchTime	Average Search Time	NULL	Average Search Time is the average time that elapsed while waiting for a search to complete
	CurrentConnections	Current Connections	NULL	The number of active connections to the WWW service.
	DownloadTaskQueued	Download Task Queued	NULL	Download Task Queued is one(1) if task is queued for execution, otherwise zero(0)
	SyncCommandsPersec	Sync Commands Per Second	NULL	Sync Commands/sec is the number of Sync commands that are processed per second. Clients use this command to synchronize items within a folder
	AvailabilityRequestssec	Availability Requests Per Second	NULL	Availability Requests per second is the number of requests serviced per second. The request can be only for free busy or include suggestions. One request may contain multiple mailboxes
	OWARequestsPersec	OWA Requests Per Second	NULL	Requests/sec is the number of requests handled by Outlook Web App per second
	AverageTimetoProcessaFreeBusyRequest	Average Time to Process a Free Busy Request	NULL	Average Time to Process a Free Busy Request is the average time to process a free busy request in seconds. One request may contain multiple mailboxes. Free busy responses do not have meeting suggestions
	AverageResponseTime	Average Response Time	NULL	Average Response Time is the average time (in milliseconds) that elapsed between the beginning and end of an OEH or ASPX request

Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Client Access Servers ASPNET (CAS ASPNET)

Description

Applicable on Exchange Servers with the Client Access servers ASPNET (CAS) role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Client Access Servers ASPNET	ApplicationRestarts	Application Restarts	NULL	Number of times the application has been restarted during the web server lifetime
	RequestWaitTime	Request Wait Time	NULL	RPC Requests outstanding is the current number of outstanding RPC requests.
	RequestsInApplicationQueue	Requests In Application Queue	NULL	The current number of requests, including those that are queued, currently executing, or waiting to be written to the client. Under the ASP.NET process model, when this counter exceeds the requestQueueLimit defined in the processModel configuration section, ASP.NET will begin rejecting requests.
	WorkerProcessRestarts	Worker Process Restarts	NULL	Number of times a worker process has restarted on the machine.
	RequestsCurrent	Requests Current	NULL	The current number of requests both executing and queued

Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Edge Transport Server (ETS)

Description

Applicable on Exchange Servers with the Edge Transport servers (ETS) role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Edge Transport Server	LargestDeliveryQueueLength	Largest Delivery Queue Length	NULL	The number of items in the largest delivery queue.
	IODatabaseReadsPersec	I/O Database Reads Per Second	NULL	I/O Database Reads/sec is the rate of database read operations completed.
	UnreachableQueueLength	Unreachable Queue Length	NULL	The number of messages in Unreachable Queue when sample was taken.
	SubmissionQueueLength	Submission Queue Length	NULL	The number of items in the submission queue when sample was taken.
	IODatabaseWritesPersec	I/O Database Writes Per Second	NULL	I/O Database Writes/sec is the rate of database write operations completed.
	LogThreadsWaiting	Log Threads Waiting	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of threads waiting for their data to be written to the log to complete an update of the database. If this number is too high, the log may be a bottleneck. This value should be less than 10 on average. Regular spikes concurrent with log record stall spikes indicate that the transaction log disks are a bottleneck. If the value for log threads waiting is more than the spindles available for the logs, there is a bottleneck on the log disks.
	DatabaseCachePercentHit	Database Cache Percent Hit	%	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the percentage of database file page requests that were fulfilled by the database cache without causing a file operation. If this percentage is too low, the database cache size may be too small. This value should be over 90% for companies with majority online mode clients. It should be over 99% for companies with majority cached mode clients. If the hit ratio is less than these numbers, the database cache may be insufficient.
	LogRecordStallsPersec	Log Record Stalls Per Second	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of log records that cannot be added to the log buffers per second because the log buffers are full. If this counter is non-zero most of the time, the log buffer size may be a bottleneck. If I/O log write latencies are high, check for RAID5 or sync replication on log devices. The average value should be below 10 per second. Spikes (maximum values) should not be higher than 100 per second.
	ActiveRemoteDeliveryQueueLength	Active Remote Delivery Queue Length	NULL	The number of messages queued for remote delivery.
	Versionbucketsallocated	Version Buckets Allocated	NULL	It provides the total number of version buckets allocated.
	AggregateDeliveryQueueLengthAllQueues	Aggregate Delivery Queue Length All Queues	NULL	The number of messages queued for aggregate delivery.
	RetryRemoteDeliveryQueueLength	Retry Remote Delivery Queue Length	NULL	Retry Remote Delivery Queue Length is the number of messages in retry in the remote delivery queues.
	PoisonQueueLength	Poison Queue Length	NULL	The number of messages in the poison message queue.

Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - HUB Transport Servers (HTS)

Description

Applicable on Exchange Servers with the HUB Transport servers (HTS) role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - HUB Transport Servers	IODatabaseReadsPersec	I/O Database Reads Per Second	NULL	I/O Database Reads/sec is the rate of database read operations completed.
	MessagesSubmittedPerSecond	Messages Submitted Per Second	NULL	This monitor is useful in assessing the efficiency and efficacy of the current design. They also provide insight into the interaction between different transport components, including the information store interface. It shows the number of messages that have been queued in the Submission queue per second.
	SubmissionQueueLength	Submission Queue Length	NULL	The number of items in the submission queue when sample was taken.
	UnreachableQueueLength	Unreachable Queue Length	NULL	The number of messages in Unreachable Queue when sample was taken.
	ActiveMailboxDeliveryQueueLength	Active Mailbox Delivery Queue Length	NULL	The number of messages queued for delivery to an active mailbox. The value format is a 4-byte integer.
	LogThreadsWaiting	Log Threads Waiting	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of threads waiting for their data to be written to the log to complete an update of the database. If this number is too high, the log may be a bottleneck. This value should be less than 10 on average. Regular spikes concurrent with log record stall spikes indicate that the transaction log disks are a bottleneck. If the value for log threads waiting is more than the spindles available for the logs, there is a bottleneck on the log disks.
	MessagesCompletedDeliveryPerSecond	Messages Completed Delivery Per Second	NULL	This monitor is useful in assessing the efficiency and efficacy of the current design. They also provide insight into the interaction between different transport components, including the information store interface. It shows the number of messages that are delivered per second.
	AggregateDeliveryQueueLengthAllQueues	Aggregate Delivery Queue Length All Queues	NULL	The number of messages queued for aggregate delivery.
	RetryMailboxDeliveryQueueLength	Retry Mailbox Delivery Queue Length	NULL	Measures the number of messages currently in the retry mailbox delivery queue. Messages in this queue are in a retry state because an issue prevented their delivery. If the issue is transient, a subsequent attempt to send the message may be successful. A queue length < 200 can be considered as OK.
	RetryNonSmtpDeliveryQueueLength	Retry Non-SMTP Delivery Queue Length	NULL	Assures the number of messages currently in the retry non-SMTP delivery queue. Messages in this queue are in a retry state because an issue prevented their delivery. If the issue is transient, a subsequent reattempt to send the message may be successful. A queue length < 200 can be considered as Ok.
	Versionbucketsallocated	Version Buckets Allocated	NULL	It provides the total number of version buckets allocated.
	ActiveNonSmtpDeliveryQueueLength	Active Non-SMTP Delivery Queue Length	NULL	The number of messages queued for delivery to a Non-SMTP transport. The value format is a 4-byte integer.
	IODatabaseWritesPersec	I/O Database Writes Per Second	NULL	I/O Database Writes/sec is the rate of database write operations completed.
	PoisonQueueLength	Poison Queue Length	NULL	The number of messages in the poison message queue.
	MessagesQueuedforDeliveryPerSecond	Messages Queued for Delivery Per Second	NULL	This monitor is useful in assessing the efficiency and efficacy of the current design. They also provide insight into the interaction between different transport components, including the information store interface. It shows the number of messages that have been queued for delivery per second.
	LargestDeliveryQueueLength	Largest Delivery Queue Length	NULL	The number of items in the largest delivery queue.
	ActiveRemoteDeliveryQueueLength	Active Remote Delivery Queue Length	NULL	The number of messages queued for remote delivery.
	LogRecordStallsPersec	Log Record Stalls Per Second	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of log records that cannot be added to the log buffers per second because the log buffers are full. If this counter is non-zero most of the time, the log buffer size may be a bottleneck. If I/O log write latencies are high, check for RAID5 or sync replication on log devices. The average value should be below 10 per second. Spikes (maximum values) should not be higher than 100 per second.

Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Mailbox Servers (MBS)

Description

Applicable on Exchange Servers with the Mailbox Servers (MBS) role

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Mailbox Servers	RPCLatencyaveragemsec	RPC Latency Average (ms)	NULL	Exchange communicates with Hub Transport servers via RPC. This counter is useful in isolating and determining issues involving the interface between the Microsoft Exchange Information Store service on the Mailbox server and Hub Transport servers. This monitor shows the average latency, in milliseconds, of RPC requests. The average is calculated over all RPCs since exrpc32 was loaded. The value should be less than 100 ms at all times.
	UserCount	User Count	NULL	This monitor shows the number of users connected to the information store. It can be used to determine current user load.
	ReplicationReceiveQueueSize	Replication Receive Queue Size	NULL	This monitor shows the number of replication messages waiting to be processed. This value should be less than 100 at all times. This value should return to a minimum value between replication intervals.
	LogThreadsWaiting	Log Threads Waiting	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of threads waiting for their data to be written to the log to complete an update of the database. If this number is too high, the log may be a bottleneck. This value should be less than 10 on average. Regular spikes concurrent with log record stall spikes indicate that the transaction log disks are a bottleneck. If the value for log threads waiting is more than the spindles available for the logs, there is a bottleneck on the log disks.
	RPCAveragedLatency	RPC Averaged Latency	Milliseconds	When you use Microsoft Office Outlook in MAPI mode, Outlook executes client operations as RPCs between the client and the server. This monitor indicates the RPC latency, in milliseconds, averaged for all operations in the last 1,024 packets. This value should not be higher than 25 ms on average. To determine if certain protocols are causing overall RPC latencies, monitor MSExchangeIS Client (*)RPC Average Latency to separate latencies based on client protocol. Cross-reference MSExchangeISRPC Client Backoff/sec to ensure higher latencies are not causing client throttling.
	RPCRequestsoutstanding	RPC Requests Outstanding	NULL	RPC Requests outstanding is the current number of outstanding RPC requests
	MessagesQueuedForSubmissionISMailbox	Messages Queued For Submission (IS Mailbox)	NULL	Mailbox servers depend on Hub Transport servers for message delivery. This monitor shows the current number of submitted messages that are not yet processed by the transport layer. This value should be below 50 at all times. A higher value for more than 15 minutes may indicate that there are connectivity issues to the transport servers or that backpressure is occurring.
	RPCNumofSlowPackets	RPC Number of Slow Packets	NULL	When you use Microsoft Office Outlook in MAPI mode, Outlook executes client operations as RPCs between the client and the server. This monitor indicates the number of RPC packets in the past 1,024 packets that have latencies longer than 2 seconds. This value should be less than 1 on average, and should be less than 3 at all times.
	RPCRequests	RPC Requests	NULL	RPC Operations/sec is the rate at which RPC operations occur.
	DatabaseCacheSizeMB	Database Cache Size (MB)	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the amount of system memory, in megabytes, used by the database cache manager to hold commonly used information from the database files to prevent file operations. If the database cache size seems too small for optimal performance and there is little available memory on the system (check the value of Memory/Available Bytes), adding more memory to the system may increase performance. If there is ample memory on the system and the database cache size is not growing beyond a certain point, the database cache size may be capped at an artificially low limit. Increasing this limit may increase performance.
	DirectoryAccessLDAPSearchesPersec	Directory Access LDAP Searches Persec	NULL	Exchange responds to client requests and attempts to fulfill them as quickly and efficiently as possible. This monitor shows the current rate that the LDAP searches occur while processing requests for the client.
	RPCOperationsPersec	RPC Operations Persec	NULL	When you use Microsoft Office Outlook in MAPI mode, Outlook executes client operations as RPCs between the client and the server. This monitor indicates the current number of RPC operations that are occurring per second. Should closely correspond to historical baselines. Values much higher than expected indicate that the workload has changed, while values much lower than expected indicate a bottleneck preventing client requests from reaching the server.
	RPCClientBackoffPersec	RPC Client Backoff Persec	NULL	Exchange throttles RPC clients to prevent individual clients from overusing server resources. This monitor shows the rate that the server notifies the client to back off. It indicates the rate at which client backoffs are occurring. Higher values may indicate that the server may be incurring a higher load resulting in an increase in overall averaged RPC latencies, causing client throttling to occur. This can also occur when certain client user actions are being performed. Depending on what the client is doing and the rate at which RPC operations are occurring, it may be normal to see backoffs occurring.
	LogRecordStallsPersec	Log Record Stalls Persec	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the number of log records that cannot be added to the log buffers per second because the log buffers are full. If this counter is non-zero most of the time, the log buffer size may be a bottleneck. If I/O log write latencies are high, check for RAID5 or sync replication on log devices. The average value should be below 10 per second. Spikes (maximum values) should not be higher than 100 per second.
	DatabasePageFaultStallsPersec	Database Page Fault Stalls Persec	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the rate that database file page requests require of the database cache manager to allocate a new page from the database cache. This should be 0 at all times. If this value is non-zero, this indicates that the database is not able to flush dirty pages to the database file fast enough to make pages free for new page allocations.
	DatabaseCachePercentHit	Database Cache Percent Hit	%	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the percentage of database file page requests that were fulfilled by the database cache without causing a file operation. If this percentage is too low, the database cache size may be too small. This value should be over 90% for companies with majority online mode clients. It should be over 99% for companies with majority cached mode clients. If the hit ratio is less than these numbers, the database cache may be insufficient.
	MessagesDeliveredPersec	Messages Delivered Persec	NULL	Exchange responds to client requests and attempts to fulfill them as quickly and efficiently as possible. This monitor shows the rate that messages are delivered to all recipients. It indicates current message delivery rate to the store.
	IODatabaseReadsAverageLatency	IO Database Reads Average Latency	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the average length of time, in milliseconds, per database read operation.
	MessagesQueuedForSubmissionISPublic	Messages Queued For Submission (IS Public)	NULL	Mailbox servers depend on Hub Transport servers for message delivery. This monitor shows the current number of submitted messages that are not yet processed by the transport layer. This value should be below 20 at all times.
	DirectoryAccessLDAPReadsPersec	Directory Access LDAP Reads Persec	NULL	Exchange responds to client requests and attempts to fulfill them as quickly and efficiently as possible. This monitor shows the current rate that the Lightweight Directory Access Protocol (LDAP) reads occur while processing requests for the client.
	ClientRPCsFailedServerTooBusyPersec	Client RPCs Failed Server Too Busy Persec	NULL	Exchange throttles RPC clients to prevent individual clients from overusing server resources. This monitor shows the client-reported rate of failed RPCs (since the store was started) due to the Server Too Busy ROC error. This value should be 0 at all times. Higher values may indicate RPC threads are exhausted or client throttling is occurring for clients running versions of Outlook earlier than Microsoft Office Outlook 2007.
	IODatabaseWritesAverageLatency	IO Database Writes Average Latency	NULL	Exchange is essentially a database application, relying upon transaction logs and database files for data integrity and storage. This monitor shows the average length of time, in milliseconds, per database write operation.

Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Mailbox Servers Replication (MBSR)

Description

Applicable on Exchange Servers with the Mailbox Servers Replication (MBSR) role

Prerequisites

NULL

Supported Metric

Agent G2 - Linux - RabbitMQ Monitors

Description

Monitors RabbitMQ monitor metrics using the rabbitmq-management plugin which provides a HTTP-based API.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Exchange 2010 DotNet v4 - Server Role - Mailbox Servers Replication	ReplayQueueLength	Replay Queue Length	NULL	This monitor indicate issues involving the replication engine and replication partners. These issues can be local or remote. This monitor shows the number of transaction log files waiting to be replayed into the passive copy. It indicates the current replay queue length. Higher values cause longer store mount times when a handoff, failover, or activation is performed.
	CopyQueueLength	Copy Queue Length	NULL	This monitor indicate issues involving the replication engine and replication partners. These issues can be local or remote. This monitor shows the number of transaction log files waiting to be copied to the passive copy log file folder. A copy is not considered complete until it has been checked for corruption. This value should be less than 10 at all times for Continuous Cluster Replication(CCR). It should be less than 1 at all times for local continuous replication (LCR).
	CallsDisconnectedbyCallersDuringUMAudioHourglass	Calls Disconnected by Callers During UM Audio Hourglass	NULL	Shows the number of calls during which the caller disconnected while Unified Messaging was playing the audio hourglass tones. This value should be 0 at all times. A non-zero value suggests excessive latency between a Unified Messaging server and targeted domain controller.
	OperationsoverSixSeconds	Operations over Six Seconds	NULL	Shows the number of all Unified Messaging operations that took more than six seconds to complete. This is the time during which a caller was waiting for Unified Messaging to respond.
	MailboxServerAccessFailures	Mailbox Server Access Failures	NULL	Shows the number of times the system did not access a Mailbox server. This value should be 0 at all times. A non-zero value indicates that Unified Messaging is having problems with MAPI connectivity to mbx servers.

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - RabbitMQ Monitors	rabbitmq.node.disk.free	RabbitMQ Free Disk	MB	The free disk of the rabbitmq node in MB.
	rabbitmq.queue.consumers.active	RabbitMQ Active Consumers	NULL	Number of active consumers. An active consumer is one which could immediately receive any messages sent to the queue.
	rabbitmq.node.mem.used	RabbitMQ Node Memory Utilization	MB	The memory used by the rabbitmq node in MB.
	rabbitmq.node.fd.used	RabbitMQ OpenFDs	NULL	Number of open file descriptors used.
	rabbitmq.queue.consumers	RabbitMQ Consumers	NULL	Number of consumers.
	rabbitmq.queue.memory	RabbitMQ Memory	MB	Memory consumed by the Erlang process associated with the queue, including stack, heap, and internal structures.
	rabbitmq.node.uptime	RabbitMQ Uptime	NULL	Uptime of the RabbitMQ server.
	rabbitmq.queue.messages	RabbitMQ Messages	NULL	Sum of ready and unacknowledged messages (queue depth).
	rabbitmq.node.sockets.used	RabbitMQ Sockets Used	NULL	Number of sockets used.
	rabbitmq.queue.messages.unacknowledged	RabbitMQ Messages Unacknowledged	NULL	Number of messages delivered to clients but not yet acknowledged.
	rabbitmq.objects.overview	RabbitMQ Overview Objects	NULL	Overview of all objects.
	rabbitmq.queue.messages.ready	RabbitMQ Messages Ready	NULL	Number of messages ready to be delivered to clients.
	rabbitmq.node.proc.used	RabbitMQ Erlang Processes Used	NULL	Number of Erlang processes used.

Agent G2 - Linux - RedisDB Monitors

Description

Monitors RedisDB application metrics

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - RedisDB Monitors	redis.clients.biggest.inputbuf	Redis Clients Biggest InputBuf	NULL	Biggest input buffer among current client connections.
	redis.mem.fragmentation_ratio	Redis-Mem.fragmentation_ratio	NULL	Ratio between rss memory used and total memory used.
	redis.mem.peak	Redis Peak Memory	MB	Peak memory consumed by Redis (in Mbytes).
	redis.aof.last.rewritetime	Redis AOF Last Rewrite Op Time	NULL	Duration of the last AOF rewrite operation in seconds.
	redis.replica.sync_left_bytes	Redis-Replica.sync_left_bytes	NULL	Number of bytes left before SYNCing is complete
	redis.rdb.last_bgsave_time	Redis-Rdb.last_bgsave_time	NULL	Duration of the last RDB save operation in seconds.
	redis.key.hits_rate	Redis Key Hit Rate	NULL	The rate of successful lookup of keys in the main dictionary.
	redis.clients.longest.outputlist	Redis Clients Longest OutputList	NULL	Longest output list among current client connections.
	redis.rdb.last.bgsavetime	Redis RDB Last Save Op Time	NULL	Duration of the last RDB save operation in seconds.
	redis.net.rejected	Redis Connections Rejected	NULL	Number of connections rejected because of maxclients limit.
	redis.clients.biggest_input_buf	Redis-Clients.biggest_input_buf	NULL	Biggest input buffer among current client connections.
	redis.uptime	Redis Uptime	NULL	Checks the uptime of the Redis service.
	redis.aof.size	Redis AOF Size	MB	AOF current file size in MB.
	redis.pubsub.patterns	Redis Pubsub Patterns	NULL	Global number of pub/sub pattern with client subscriptions.
	redis.stats.keyspace_hits	Redis Keyspace Hits	NULL	Number of successful lookup of keys in the main dictionary per second.
	redis.clients.longest_output_list	Redis-Clients.longest_output_list	NULL	Longest output list among current client connections.
	redis.key.misses_rate	Redis Key Miss Rate	NULL	The rate of failed lookup of keys in the main dictionary.
	redis.net.commands	Redis Commands	NULL	The number of commands processed by the server
	redis.replica.syncleftbytes	Redis Replication Bytes Lag	NULL	Number of bytes left before SYNCing is complete
	redis.keyspace.misses	Redis Keyspace Misses	NULL	Number of failed lookup of keys in the main dictionary per second.
	redis.keys.evicted	Redis Evicted Keys	NULL	Number of evicted keys due to maxmemory limit.
	redis.perf.latest_fork_usec	Redis Latest Fork Op Time	NULL	Duration of the latest fork operation in microseconds.
	redis.net.clients	Redis Client Connections	NULL	Number of client connections (excluding connections from slaves).
	redis.changes	Redis Changes	NULL	Number of changes since the last save.
	redis.keys.total	Redis Total Keys	NULL	Provides the total number of keys from all the DBs.
	redis.mem.rss	Redis RSS Memory	MB	Number of bytes that Redis allocated as seen by the operating system (a.k.a resident set size). This is the number reported by tools such as top and ps.
	redis.rdb.changes	Redis RDB Changes	NULL	Number of changes since the last dump.
	redis.pubsub.channels	Redis Pubsub Channels	NULL	Global number of pub/sub channels with client subscriptions.
	redis.replica.last_io_seconds_ago	Redis-Replica.last_io_seconds_ago	NULL	Number of seconds since the last interaction with master.
	redis.clients.blocked	Redis Clients Blocked	NULL	Number of clients pending on a blocking call.
	redis.mem.lua	Redis LUA Memory	MB	Number of Mbytes used by the Lua engine.
	redis.mem.used	Redis Used Memory	MB	Total number of Mbytes allocated by Redis using its allocator (either standard libc, jemalloc, or an alternative allocator such as tcmalloc).
	redis.replica.last.io.Secondsago	Redis Replication Lag	NULL	Number of seconds since the last interaction with master.
	redis.connections	Redis Connections	NULL	The number of connections accepted by the server per second.
	redis.mem.fragmentation.ratio	Redis Memory Fragmentation Ratio	NULL	Ratio between rss memory used and total memory used.
	redis.keys.expired	Redis Expired Keys	NULL	Total number of key expiration events.
	redis.aof.last_rewrite_time	Redis-Aof.last_rewrite_time	NULL	Duration of the last AOF rewrite operation in seconds.
	redis.net.slaves	Redis Connected Slaves	NULL	Number of connected slaves.

Agent G2 - Linux - Riak DB Monitors

Description

Agent G2 - Linux - Riak DB Monitors

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - Riak DB Monitors	riak.node_get_fsm_objsize_mean	Riak Get Fsm Mean Object Size	NULL	Mean object size encountered by this node within the last minute
	riak.redir_requests	Riak Redirected Requests	NULL	Average number of requests this node has redirected to other nodes for coordination per second
	riak.pipe_vnodes.running.count	Riak Running Pipe Vnodes	NULL	Number of pipe virtual node queues running in the last minute
	riak.vnode_index_writes	Riak Vnode Index Writes	NULL	Average number of vnode index write operations performed per second
	riak.node_get_fsm_objsize_95	Riak Get Fsm 95 Object Size	NULL	95th percentile object size encountered by this node within the last minute
	riak.node_get_fsm_siblings_100	Riak Get Fsm 100 Siblings	NULL	100th percentile of siblings encountered during all GET operations by this node within the last minute
	riak.node_gets	Riak Node GETs	NULL	Average number of GETs coordinated by this node per second, including GETs to non-local vnodes
	riak.node_get_fsm_objsize_100	Riak Get Fsm 100 Object Size	NULL	100th percentile object size encountered by this node within the last minute
	riak.vnode_index_reads	Riak Vnode Index Reads	NULL	Average number of vnode index read operations performed per second
	riak.ring_num_partitions	Riak Ring Partitions	NULL	Number of partitions in the ring
	riak.pipeline.active	Riak Active Pipelines	NULL	The number of pipelines active in the last 60 seconds
	riak.vnode.puts	Riak Vnode PUTs	NULL	Average number of PUTS coordinated by local vnodes per second
	riak.node_get_fsm_objsize_median	Riak Get Fsm Median Object Size	NULL	Median object size encountered by this node within the last minute
	riak.node_put_fsm_time_95	Riak Put Fsm 95 Time	NULL	95th percentile time between reception of client PUT request and subsequent response to client
	riak.sys.process_count	Riak Process Count	NULL	Number of Erlang processes
	riak.node_get_fsm_time_100	Riak Get Fsm 100 Time	NULL	100th percentile time between reception of client GET request and subsequent response to client
	riak.node_get_fsm_time_mean	Riak Get Fsm Mean Time	NULL	Mean time between reception of client GET request and subsequent response to client
	riak.node_get_fsm_siblings_mean	Riak Get Fsm Mean Siblings	NULL	Mean number of siblings encountered during all GET operations by this node within the last minute
	riak.vnode.gets	Riak Vnode GETs	NULL	Average number of GETs coordinated by local vnodes per second
	riak.node_get_fsm_siblings_median	Riak Get Fsm Median Siblings	NULL	Median number of siblings encountered during all GET operations by this node within the last minute
	riak.node_get_fsm_siblings_95	Riak Get Fsm 95 Siblings	NULL	95th percentile of siblings encountered during all GET operations by this node within the last minute
	riak.precommit.fails	Riak Pre-commit Failures	NULL	Number of pre commit hook failures
	riak.node_get_fsm_time_median	Riak Get Fsm Median Time	NULL	Median time between reception of client GET request and subsequent response to client
	riak.pipeline.errors	Riak Pipeline Errors	NULL	The average number of pipeline creation errors per second
	riak.kv_vnodes.running.count	Riak Running KV Vnodes	NULL	Number of key/value virtual node queues running in the last minute
	riak.postcommit.fails	Riak Post-commit Failures	NULL	Number of post commit hook failures
	riak.pbc_active	Riak Active PB Connections	NULL	Number of currently active protocol buffer connections
	riak.node_put_fsm_time_median	Riak Put Fsm Median Time	NULL	Median time between reception of client PUT request and subsequent response to client
	riak.vnode_index_deletes	Riak Vnode Index Deletes	NULL	Average number of vnode index delete operations performed per second
	riak.node_put_fsm_time_mean	Riak Put Fsm Mean Time	NULL	Mean time between reception of client PUT request and subsequent response to client
	riak.node_put_fsm_time_100	Riak Put Fsm 100 Time	NULL	100th percentile time between reception of client PUT request and subsequent response to client
	riak.node.puts	Riak Node PUTs	NULL	Average number of PUTs coordinated by this node per second, including PUTs to non-local vnodes
	riak.pipeline.creates	Riak Pipeline Creations	NULL	The average number of pipelines created per second
	riak.node_get_fsm_time_95	Riak Get Fsm 95 Time	NULL	95th percentile time between reception of client GET request and subsequent response to client
	riak.pbc_connects	Riak New PB Connections	NULL	Number of new protocol buffer connections established during the last minute
	riak.memory.processes_used	Riak Memory Used	NULL	Total amount of memory used by Erlang processes
	riak.read_repairs	Riak Read Repairs	NULL	Average number of read repair operations this node has coordinated per second

Agent G2 - Linux - RiakDB Monitors

Description

It monitors DB parameters like Post-commit Failures, Pre-commit Failures, Node GETs, Vnode GETs, Memory Used, Get Fsm 100 Object Size, Get Fsm 100 Siblings, Get Fsm 100 Time, Get Fsm 95 Object Size, Get Fsm 95 Siblings, Get Fsm 95 Time, Get Fsm Mean Object Size, Get Fsm Mean Siblings, Get Fsm Mean Time, Get Fsm Median Object Size, Get Fsm Median Siblings, Get Fsm Median Time, Put Fsm 100 Time, Put Fsm 95 Time, Put Fsm Mean Time, Put Fsm Median Time, Active PB Connections, New PB Connections, Active Pipelines, Pipeline Creations, Pipeline Errors, Node PUTs, Vnode PUTs, Read Repairs, Redirected Requests, Ring Partitions, Running KV Vnodes, Running Pipe Vnodes, Process Count, Vnode Index Deletes, Vnode Index Reads, Vnode Index Writes

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - RiakDB Monitors	riak.postcommit.fails	Riak Post-commit Failures	NULL	Number of post commit hook failures
	riak.pbc_active	Riak Active PB Connections	NULL	Number of currently active protocol buffer connections
	riak.vnode_index_deletes	Riak Vnode Index Deletes	NULL	Average number of vnode index delete operations performed per second
	riak.node_get_fsm_time_mean	Riak Get Fsm Mean Time	NULL	Mean time between reception of client GET request and subsequent response to client
	riak.node_get_fsm_objsize_median	Riak Get Fsm Median Object Size	NULL	Median object size encountered by this node within the last minute
	riak.vnode_index_reads	Riak Vnode Index Reads	NULL	Average number of vnode index read operations performed per second
	riak.node_get_fsm_time_95	Riak Get Fsm 95 Time	NULL	95th percentile time between reception of client GET request and subsequent response to client
	riak.node_put_fsm_time_95	Riak Put Fsm 95 Time	NULL	95th percentile time between reception of client PUT request and subsequent response to client
	riak.pipeline.active	Riak Active Pipelines	NULL	The number of pipelines active in the last 60 seconds
	riak.pipe_vnodes.running.count	Riak Running Pipe Vnodes	NULL	Number of pipe virtual node queues running in the last minute
	riak.ring_num_partitions	Riak Ring Partitions	NULL	Number of partitions in the ring
	riak.memory.processes_used	Riak Memory Used	NULL	Total amount of memory used by Erlang processes
	riak.node_get_fsm_siblings_100	Riak Get Fsm 100 Siblings	NULL	100th percentile of siblings encountered during all GET operations by this node within the last minute
	riak.node_get_fsm_objsize_mean	Riak Get Fsm Mean Object Size	NULL	Mean object size encountered by this node within the last minute
	riak.node_get_fsm_time_median	Riak Get Fsm Median Time	NULL	Median time between reception of client GET request and subsequent response to client
	riak.pbc_connects	Riak New PB Connections	NULL	Number of new protocol buffer connections established during the last minute
	riak.vnode.puts	Riak Vnode PUTs	NULL	Average number of PUTS coordinated by local vnodes per second
	riak.node_put_fsm_time_mean	Riak Put Fsm Mean Time	NULL	Mean time between reception of client PUT request and subsequent response to client
	riak.redir_requests	Riak Redirected Requests	NULL	Average number of requests this node has redirected to other nodes for coordination per second
	riak.node_put_fsm_time_median	Riak Put Fsm Median Time	NULL	Median time between reception of client PUT request and subsequent response to client
	riak.node.gets	Riak Node GETs	NULL	Average number of GETs coordinated by this node per second, including GETs to non-local vnodes
	riak.node_get_fsm_objsize_95	Riak Get Fsm 95 Object Size	NULL	95th percentile object size encountered by this node within the last minute
	riak.kv_vnodes.running.count	Riak Running KV Vnodes	NULL	Number of key/value virtual node queues running in the last minute
	riak.node_get_fsm_siblings_median	Riak Get Fsm Median Siblings	NULL	Median number of siblings encountered during all GET operations by this node within the last minute
	riak.read_repairs	Riak Read Repairs	NULL	Average number of read repair operations this node has coordinated per second
	riak.node_put_fsm_time_100	Riak Put Fsm 100 Time	NULL	100th percentile time between reception of client PUT request and subsequent response to client
	riak.sys.process_count	Riak Process Count	NULL	Number of Erlang processes
	riak.vnode.gets	Riak Vnode GETs	NULL	Average number of GETs coordinated by local vnodes per second
	riak.node_get_fsm_siblings_mean	Riak Get Fsm Mean Siblings	NULL	Mean number of siblings encountered during all GET operations by this node within the last minute
	riak.pipeline.errors	Riak Pipeline Errors	NULL	The average number of pipeline creation errors per second
	riak.precommit.fails	Riak Pre-commit Failures	NULL	Number of pre commit hook failures
	riak.pipeline.creates	Riak Pipeline Creations	NULL	The average number of pipelines created per second
	riak.node.puts	Riak Node PUTs	NULL	Average number of PUTs coordinated by this node per second, including PUTs to non-local vnodes
	riak.vnode_index_writes	Riak Vnode Index Writes	NULL	Average number of vnode index write operations performed per second
	riak.node_get_fsm_siblings_95	Riak Get Fsm 95 Siblings	NULL	95th percentile of siblings encountered during all GET operations by this node within the last minute
	riak.node_get_fsm_objsize_100	Riak Get Fsm 100 Object Size	NULL	100th percentile object size encountered by this node within the last minute
	riak.node_get_fsm_time_100	Riak Get Fsm 100 Time	NULL	100th percentile time between reception of client GET request and subsequent response to client

Agent G2 - Linux Services Monitoring

Description

Monitors the status of the overall state the service is in. It can be active, reloading, inactive, failed, activating, or deactivating.

Template Usage Guidelines:

While applying this template on the device, users need to provide specific input parameters in below two formats only.

Format 1: all (case-insensitive) If “all” is specified as custom script arguments, the script monitors all available services along with alert tokens, that provide additional information, including the total count of services and the count of services in each available state.
Format 2: tuned,opsramp.*, systemd (provide service names without .service extension as shown here) Users can specify comma-separated service names or service regex patterns for a more focused monitoring approach. The script filters and retrieves status information about the mentioned services only.

Note: We strongly recommend specifying only particular service names in input parameters,(that is Format 2) as monitoring all services may significantly increase the system load, especially in environments with a large number of services.

Prerequisites

This template only works on systems having Systemd as the default init system.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux Services Monitor	system_linux_services_status	System Linux Services Status	-	Monitors the status of the overall state the service is in. It can be active, reloading, inactive, failed, activating, or deactivating.

Agent G2 - Linux - Squid Monitors

Description

Monitoring template for squid proxy application

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - Squid Monitors	squid.server.errors	Squid Server Errors	NULL	Rate of server requests that resulted in error
	squid.fqdn.cache.entries	Squid FQDN Cache Entries	NULL	Number of FQDN cache entries
	squid.icp.packets.received	Squid ICP Packets Received	NULL	Rate of ICP packets received
	squid.icp.traffic.in	Squid ICP Traffic In	NULL	Amount of ICP data received
	squid.server.traffic.in	Squid Server Traffic In	NULL	Rate of traffic read by server for all protocols
	squid.icp.packets.sent	Squid ICP Packets Sent	NULL	Rate of ICP packets sent
	squid.request.failure.ratio	Squid Request Failure Ratio	%	The average ratio between the number of failed and successful requests
	squid.service.times	Squid Service Times	NULL	The median of various service time (or response time) distributions
	squid.server.traffic.out	Squid Server Traffic Out	NULL	Rate of traffic written to origin servers for all protocols
	squid.page.faults	Squid Page Faults	NULL	Page faults with physical i/o
	squid.icp.replies.queued	Squid ICP Replies Queued	NULL	This counter shows how many times an ICP message was queued for re-transmission
	squid.server.requests	Squid Server Requests	NULL	Rate of server-side requests to HTTP servers
	squid.unlink.requests	Squid Unlink Requests	NULL	Rate of unlink requests
	squid.client.http.requests	Squid Client Http Requests	NULL	The rate of the number of HTTP requests.
	squid.client.http.traffic.out	Squid Client Http Traffic Out	NULL	Rate of response data traffic sent to clients
	squid.aborted.requests	Squid Aborted Requests	NULL	Rate of aborted requests
	squid.requests.disk.hit.ratio	Squid Requests Disk Hit Ratio	%	These values represent the percentage of plain cache hits served from disk
	squid.cache.hit.ratio	Squid Cache Hit Ratio	%	The percentage of HTTP requests that result in a cache hit.
	squid.clients	Squid Clients	NULL	Number of clients accessing cache, client actually means IP address. Squid assumes that each client has a unique IP address
	squid.client.http.errors	Squid Client Http Errors	NULL	The rate of the number of HTTP errors.
	squid.client.http.traffic.in	Squid Client Http Traffic In	NULL	Rate of request data traffic received from clients
	squid.fqdn.cache.statistics	Squid FQDN Cache Statistics	NULL	The FQDN cache is similar to the IP cache, except that it stores address-to-hostname lookups
	squid.ip.cache.entries	Squid IP Cache Entries	NULL	Number of IP cache entries
	squid.icp.messages.sent	Squid ICP Messages Sent	NULL	The total number of ICP messages sent since Squid was started.
	squid.icp.messages.received	Squid ICP Messages Received	NULL	The total number of ICP messages received since Squid was started.
	squid.cache.byte.hit.ratio	Squid Cache Byte Hit Ratio	%	Squid calculates byte hit ratio by comparing the number of bytes received from origin servers (or neighbors) to the number of bytes sent to clients
	squid.select.loops	Squid Select Loops	NULL	Rate of select loops called
	squid.ip.cache.statistics	Squid IP Cache Statistics	NULL	The IP cache contains cached results of hostname-to-address lookups.
	squid.request.memory.hit.ratio	Squid Request Memory Hit Ratio	%	These values represent the percentage of all cache hits that were served from memory
	squid.icp.traffic.out	Squid ICP Traffic Out	NULL	Amount of ICP data sent

Agent G2 - Linux - Varnish Monitors

Description

Varnish application monitoring

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - Varnish Monitors	varnish.uptime	Varnish Uptime	NULL	Uptime in minutes
	varnish.client.conns.accepted	Varnish Client Connections Accepted	NULL	Average number of client connections accepted per second
	varnish.rate.esi.errors	Varnish ESI Errors	NULL	Rate of ESI parsing errors
	varnish.rate.hdrbytes	Varnish Header Size	NULL	Rate of total header size in Kbytes
	varnish.cache.hits	Varnish Cache Hits	NULL	Cache hit rate
	varnish.struct.objects	Varnish Objects	NULL	Number of objects
	varnish.backend.conns.success.ratio	Varnish Backend Connections Success Ratio	NULL	Successful backend server connections ratio
	varnish.client.connections.ratio	Varnish Client Connections Ratio	NULL	Client accepted connections to received requests ratio
	varnish.client.conns.dropped	Varnish Client Connections Dropped	NULL	Average number of client connections dropped per second
	varnish.lru.objects.moved	Varnish LRU Moved Objects	NULL	Number of LRU moved objects
	varnish.work.thread.ratio	Varnish Work Thread Ratio	NULL	Working threads to created threads ratio
	varnish.rate.sessions	Varnish Sessions	NULL	Rate of total sessions
	varnish.backend.connections	Varnish Backend Connections	NULL	Rate of backend connections success
	varnish.rate.bodybytes	Varnish Body Size	NULL	Rate of total body size in Kbytes
	varnish.abandoned.work.requests	Varnish Dropped Work Requests	NULL	Average number of abandoned work requests per second
	varnish.client.requests	Varnish Client Requests	NULL	Average number of client requests received per second
	varnish.cache.hit.ratio	Varnish Cache Hit Ratio	NULL	Cache hit ratio
	varnish.expired.objects	Varnish Expired Objects	NULL	Number of expired objects
	varnish.worker.threads	Varnish Worker Threads	NULL	Number of worker threads
	varnish.rate.requests	Varnish Requests	NULL	Rate of total received requests
	varnish.rate.fetches	Varnish Fetches	NULL	Rate of total fetches
	varnish.backend.recycle	Varnish Backend Connection Recycles	NULL	Rate of backend connection recycles
	varnish.cache.miss.ratio	Varnish Cache Miss Ratio	NULL	Cache miss ratio
	varnish.backend.req	Varnish Backend Requests	NULL	Rate of backend requests made
	varnish.lru.objects.nuked	Varnish LRU Nuked Objects	NULL	Number of LRU nuked objects
	varnish.backend.fail	Varnish Backend Connections Failed	NULL	Rate of backend connection failures
	varnish.worker.threads.failed	Varnish Failed Worker Threads	NULL	Average number of failures per second, when creating worker threads
	varnish.backend.busy	Varnish Backend Connections Busy	NULL	Rate of backend connections busy
	varnish.backend.toolate	Varnish Backend Connections Closed	NULL	Rate of backend connections closed
	varnish.cache.misses	Varnish Cache Misses	NULL	Cache miss rate

Agent G2 - Linux - WebLogic Monitors

Description

Agent G2 - Linux - WebLogic Monitors

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - WebLogic Monitors	weblogic_ejp_transactions_committed_count	Transactions Committed Count Rate	Per Second	EJB Transactions Committed Count Rate
	weblogic_ejp_access_count	Access Count Rate	Per Second	EJBPool Access Count Rate
	weblogic_jdbc_ds_curr_capacity	Curr Capacity	NULL	JDBC DataSource Curr Capacity
	weblogic_jta_transaction_rolled_back_count	JTARuntime Transaction Rolled Back Count Rate	Per Second	JTARuntime Transaction Rolled Back Count Rate
	weblogic_thread_count	Thread Count	NULL	Thread Count Of The Server
	weblogic_gc_collection_time	Collection Time	NULL	Time Taken For Collection Of The Garbage Objects
	weblogic_ejp_beans_in_use_current_count	Beans In Use Current Count	NULL	EJBPool Beans In Use Current Count
	weblogic_jdbc_ds_active_connections_current_count	Active Connections Current Count	NULL	JDBC DataSource Active Connections Current Count
	weblogic_ejp_transactions_rolled_back_count	Transactions Rolled Back Count Rate	Per Second	EJB Transactions Rolled Back Count Rate
	weblogic_jdbc_ds_leaked_connection_count	Leaked Connection Count	Per Second	JDBC DataSource Leaked Connection Count
	weblogic_ejp_pooled_beans_current_count	Pooled Beans Current Count	NULL	EJBPool Pooled Beans Current Count
	weblogic_ejp_destroyed_count	Destroyed Count Rate	Per Second	EJBPool Destroyed Count Rate
	weblogic_open_file_descriptor_count	Open File Descriptor Count	NULL	Number Of Open File Descriptors Of The Server
	weblogic_jdbc_ds_connections_count	Connections Count Rate	Per Second	JDBC DataSource Connections Count Rate
	weblogic_non_heap_memory_usage_used	Non Heap Memory Usage Used	MB	Non Heap Memory Usage Of The Server
	weblogic_thread_pool_standby_thread_count	Standby Thread Count	NULL	Standby Thread Count
	weblogic_ejp_transactions_timed_out_count	Transactions Timed Out Count Rate	Per Second	EJB Transactions Timed Out Count Rate
	weblogic_gc_collection_count	Collection Count	NULL	Number Of Garbage Objects Collected
	weblogic_heap_memory_usage_committed	Heap Memory Usage Committed	MB	Heap Memory Committed For The Server
	weblogic_uptime	WebLogic Uptime	Minutes	WebLogic Uptime
	weblogic_ejp_waiter_current_count	Waiter Current Count	NULL	EJBPool Waiter Current Count
	weblogic_total_started_thread_count	Total Started Thread Count	NULL	Total Started Thread Count
	weblogic_thread_pool_hogging_thread_count	Hogging Thread Count	NULL	Hogging Thread Count
	weblogic_jdbc_ds_waiting_for_connection_success	Waiting For Connection Success Rate	Per Second	JDBC DataSource Waiting For Connection Success Rate
	weblogic_jdbc_ds_waiting_for_connection	Waiting For Connection Rate	Per Second	JDBC DataSource Waiting For Connection Rate
	weblogic_jdbc_ds_num_available	Num Available	NULL	JDBC DataSource Num Available
	weblogic_jdbc_ds_prep_stmt_cache_current_size	Prep Stmt Cache Current Size	NULL	JDBC DataSource Prep Stmt Cache Current Size
	weblogic_thread_pool_execute_thread_idle_count	Execute Thread Idle Count	NULL	Execute Thread Idle Count
	weblogic_ejp_miss_count	Miss Count Rate	Per Second	EJBPool Miss Count Rate
	weblogic_loaded_class_count	Loaded Class Count	NULL	Loaded Class Count
	weblogic_jta_transaction_count	JTARuntime Transaction Count Rate	Per Second	JTARuntime Transaction Count Rate
	weblogic_jdbc_ds_waiting_for_connection_failure	Waiting For Connection Failure Rate	Per Second	JDBC DataSource Waiting For Connection Failure Rate
	weblogic_jta_transaction_abandoned_count	JTARuntime Transaction Abandoned Count Rate	Per Second	JTARuntime Transaction Abandoned Count Rate
	weblogic_unloaded_class_count	Unloaded Class Count	NULL	Unloaded Class Count
	weblogic_jdbc_ds_waiting_for_connection_current_count	Waiting For Connection Current Count	NULL	JDBC DataSource Waiting For Connection Current Count
	weblogic_jta_transaction_committed_count	JTARuntime Transaction Committed Count Rate	Per Second	JTARuntime Transaction Committed Count Rate
	weblogic_heap_memory_usage_used	Heap Memory Usage Used	MB	Heap Memory Usage Of The Server
	weblogic_non_heap_memory_usage_committed	Non Heap Memory Usage Committed	MB	Non Heap Memory Committed For The Server

Agent G2 - Linux - WebSphere Monitors

Description

Agent G2 - Linux - WebSphere Monitors

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux - WebSphere Monitors	ibm_was_jdbc_FaultCount	JDBC Fault Count	NULL	The total number of faults, such as timeouts, in the connection pool.
	ibm_was_servlet_session_LiveCount	Servlet Session Live Count	NULL	The number of local sessions that are currently cached in memory from the time at which this metric is enabled.
	ibm_was_jdbc_CreateCount	JDBC Create Count	NULL	The total number of managed connections that were created since pool creation.
	ibm_was_servlet_session_NoRoomForNewSessionCount	Servlet Session No Room For New Session Count	NULL	Applies only to session in memory with AllowOverflow=false. The number of times that a request for a new session cannot be handled because it exceeds the maximum session count.
	ibm_was_thread_pools_ActiveTime	Thread Pools Active Time	ms	The average time in milliseconds the threads are in active state
	ibm_was_jvm_ProcessCpuUsage	JVM Process Cpu Usage Gauge	NULL	The CPU Usage (in percent) of the Java virtual machine.
	ibm_was_thread_pools_ClearedThreadHangCount	Thread Pools Cleared Thread Hang Count	NULL	The number of thread hangs cleared
	ibm_was_servlet_session_LifeTime	Servlet Session Life Time	ms	The average session life time in milliseconds (time invalidated - time created)
	ibm_was_servlet_session_ActiveCount	Servlet Session Active Count	NULL	The number of concurrently active sessions. A session is active if the WebSphere Application Server is currently processing a request that uses that session.
	ibm_was_thread_pools_DeclaredThreadHungCount	Thread Pools Declaredthread Hung Count	NULL	The number of threads declared hung
	ibm_was_thread_pools_ActiveCount	Thread Pools Active Count	NULL	The number of concurrently active threads
	ibm_was_servlet_session_CreateCount	Servlet Session Create Count	NULL	The number of sessions that were created
	ibm_was_servlet_session_CacheDiscardCount	Servlet Session Cache Discard Count	NULL	The number of session objects that have been forced out of the cache. A least recently used (LRU) algorithm removes old entries to make room for new sessions and cache misses. Applicable only for persistent sessions.
	ibm_was_jdbc_ReturnCount	JDBC Return Count	NULL	The total number of managed connections that were returned since pool creation.
	ibm_was_jvm_UsedMemory	JVM Used Memory Gauge	KB	The used memory in the JVM run time
	ibm_was_jdbc_PrepStmtCacheDiscardCount	JDBC Prep Stmt Cache Discard Count	NULL	The total number of statements that are discarded by the least recently used (LRU) algorithm of the statement cache.
	ibm_was_jdbc_FreePoolSize	JDBC Free Pool Size	NULL	The number of managed connections that are in the free pool.
	ibm_was_jvm_UpTime	JVM Up Time Gauge	Seconds	The amount of time that the JVM is running
	ibm_was_jdbc_CloseCount	JDBC Close Count	NULL	The total number of managed connections that were destroyed since pool creation.
	ibm_was_thread_pools_PoolSize	Thread Pools Pool Size	NULL	The average number of threads in pool
	ibm_was_servlet_session_InvalidateCount	Servlet Session Invalidate Count	NULL	The number of sessions that were invalidated
	ibm_was_servlet_session_ExternalWriteTime	Servlet Session External Write Time	ms	The time (milliseconds) taken to write the session data from the persistent store. Applicable only for (serialized) persistent sessions. Similar to external Read Time.
	ibm_was_jdbc_WaitTime	JDBC Wait Time	NULL	The average waiting time in milliseconds until a connection is granted if a connection is not currently available.
	ibm_was_thread_pools_CreateCount	Thread Pools Create Count	NULL	The total number of threads created
	ibm_was_jdbc_AllocateCount	JDBC Allocate Count	NULL	The total number of managed connections that were allocated since pool creation.
	ibm_was_jdbc_JDBCTime	JDBC Time	NULL	The average time in milliseconds spent running in the JDBC driver that includes time that is spent in the JDBC driver, network, and database.
	ibm_was_servlet_session_TimeSinceLastActivated	Servlet Session Time Since Last Activated	ms	The time difference in milliseconds between previous and current access time stamps. Does not include session time out.
	ibm_was_jdbc_PercentUsed	JDBC Percent Used	NULL	The percent of the pool that is in use.
	ibm_was_thread_pools_DestroyCount	Thread Pools Destroy Count	NULL	The total number of threads destroyed
	ibm_was_jdbc_WaitingThreadCount	JDBC Waiting Thread Count	NULL	The number of threads that are currently waiting for a connection.
	ibm_was_thread_pools_PercentMaxed	Thread Pools Percent Maxed	NULL	The average percent of the time that all threads are in use
	ibm_was_servlet_session_ExternalReadSize	Servlet Session External Read Size	Bytes	Size of the session data read from persistent store. Applicable only for (serialized) persistent sessions
	ibm_was_thread_pools_ConcurrentHungThreadCount	Thread Pools Concurrent Hung Thread Count	NULL	The number of concurrently hung threads
	ibm_was_jvm_FreeMemory	JVM Free Memory Gauge	KB	The free memory in the JVM run time
	ibm_was_jdbc_UseTime	JDBC Use Time	NULL	The average time in milliseconds that a connection is in use.
	ibm_was_servlet_session_ExternalWriteSize	Servlet Session External Write Size	Bytes	The size of the session data written to persistent store. Applicable only for (serialized) persistent sessions. Similar to external Read Time.
	ibm_was_servlet_session_SessionObjectSize	Servlet Session Session Object Size	Bytes	The size in bytes of (the serializable attributes of ) in-memory sessions. Only session objects that contain at least one serializable attribute object is counted. A session can contain some attributes that are serializable and some that are not. The size in bytes is at a session level.
	ibm_was_jdbc_PoolSize	JDBC Pool Size	NULL	The size of the connection pool.
	ibm_was_jdbc_PercentMaxed	JDBC Percent Maxed	NULL	The percent of the time that all connections are in use.
	ibm_was_servlet_session_TimeoutInvalidationCount	Servlet Session Timeout Invalidation Count	NULL	The number of sessions that are invalidated by timeout.
	ibm_was_servlet_session_ExternalReadTime	Servlet Session External Read Time	ms	The time (ms) taken in reading the session data from the persistent store. For multirow sessions, the metrics are for the attribute; for single row sessions, the metrics are for the entire session. Applicable only for persistent sessions. When using a JMS persistent store, only available if replicated data is serialized.
	ibm_was_jdbc_ConnectionHandleCount	JDBC Connection Handle Count	NULL	The number of connections that are in use. Can include multiple connections that are shared from a single managed connection.
	ibm_was_jdbc_ManagedConnectionCount	JDBC Managed Connection Count	NULL	The total number of managed connections in the free, shared, and unshared pools.
	ibm_was_servlet_session_AffinityBreakCount	Servlet Session Affinity Break Count	NULL	The number of requests that are received for sessions that were last accessed from another web application. This value can indicate failover processing or a corrupt plug-in configuration.
	ibm_was_jvm_HeapSize	JVM Heap Size Gauge	KB	The total memory in the JVM run time
	ibm_was_servlet_session_ActivateNonExistSessionCount	Servlet Session Activate Non Exist Session Count	NULL	The number of requests for a session that no longer exists, presumably because the session timed out. Use this counter to help determine if the timeout is too short.

Agent G2 - Linux Directory Monitor - v2

Description

Agent G2 - Linux Directory Monitor

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Linux Directory Monitor - v2	system_directory_Size	System Directory Size	GB	System Directory Size: To monitor the total size of the given directory/file path
	system_directory_file_ReadOnlyStatus	System Directory File ReadOnlyStatus	NULL	System Directory File ReadOnlyStatus - To monitor the Filtered File(s) Read Accessibility. 0 - Read Only, 1 - Other than Read Only
	system_directory_FileCount	System Directory File Count	count	System Directory File Count: To monitor the file count in a given directory based on given regex pattern
	system_directory_FileSize	System Directory File Size	KB	System Directory File Size: To monitor the each file size in a given directory path and filtering files based given regex pattern.
	system_directory_FileSizeTotal	System Directory FileSizeTotal	MB	System Directory FileSizeTotal: To monitor the total size of filtered files in a given directory based on given regex pattern.
	system_directory_Availability	System Directory Availability	NULL	System Directory Availability: To monitor the availability of given Directory/File path. Below are the possible states: 1 - Available, 0 - Not Available

Agent G2 - Linux Network Monitoring

Description

Agent G2 - Linux Network Monitoring

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux Network Monitor	system.network.interface.discards.in	System Network In discards	psec	Monitors Network in discards of each interface for Linux Devices
	system.network.interface.discards.out	System Network Out Discards	psec	Monitors network Out Discards of each interface for Linux Devices
	system.network.interface.errors.in	System Network In Errors	Errors per Sec	Monitors network in errors of each interface for Linux Devices
	system.network.interface.errors.out	System Network Out Errors	Errors per Sec	Monitors Network Out traffic of each interface for Linux Devices
	system.network.interface.packets.in	System Network In packets	packets/sec	Monitors in Packets of each interface for Linux Devices
	system.network.interface.packets.out	System Network out packets	packets/sec	Monitors Out packets of each interface for Linux Devices
	system.network.interface.traffic.in	System Network In traffic	Kbps	Monitors In traffic of each interface for Linux Devices
	system.network.interface.traffic.out	System Network Out Traffic	Kbps	Monitors Out traffic of each interface for Linux Devices

Agent G2 - Linux NFS Mount Point Monitoring

Description

Template to monitor linux nfs mount points availability, accessibility and utilization. This template need to assigned on all linux NFS client machines. This template tested in “CentOS7” + NFS mount points available.

Prerequisites

NFS Mount points(which are related to NFS file system) available on target device.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux NFS Mount Point Custom Monitor	system_linux_nfs_mountpoint_accessibility	System Linux NFS Mountpoint Accessibility	NULL	System Linux NFS Mountpoint Accessibility - Below are the possible values: 1 - Read/Write access not available 0 - Read/Write access available
	system_linux_nfs_mountpoint_utilization	System Linux NFS Mountpoint Utilization	%	System Linux NFS Mountpoint Utilization
	system_linux_nfs_mountpoint_availability	System Linux NFS Mountpoint Availability	NULL	System Linux NFS Mountpoint Availability - Below are the possible values: 1 - NFS Mount Point Not Available 0 - NFS Mount Point Available

Agent G2 - Linux NFS Mount Point Monitoring - V2

Description

Template to monitor linux NFS mount points availability, accessibility and utilization and . In this version-2, mountpoint name is set as the component in both graph and alert. where as, previously in version-1 ,the component is the file system name. This template need to assigned on all linux NFS client machines.

Prerequisites

NFS Mount points(which are related to NFS file system) available on target device.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux NFS Mount Point Custom Monitor-V2	system_linux_nfs_mountpoint_accessibility	System Linux NFS Mountpoint Accessibility		System Linux NFS Mountpoint Accessibility - Below are the possible values: 1 - Read/Write access not available 0 - Read/Write access available
	system_linux_nfs_mountpoint_utilization	System Linux NFS Mountpoint Utilization	%	System Linux NFS Mountpoint Utilization
	system_linux_nfs_mountpoint_availability	System Linux NFS Mountpoint Availability		System Linux NFS Mountpoint Availability - Below are the possible values: 1 - NFS Mount Point Not Available 0 - NFS Mount Point Available

Agent G2 - Linux NFS Mount Point Monitoring - v3

Description

Template to monitor Linux NFS mount points availability, accessibility and utilization. This template need to assigned on all linux NFS client machines.

Prerequisites

NFS Mount points(which are related to NFS file system) available on target device.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux NFS Mount Point Custom Monitor - v3	system_linux_nfs_mountpoint_accessibility	System Linux NFS Mountpoint Accessibility		System Linux NFS Mountpoint Accessibility - Below are the possible values: 1 - Read/Write access not available 0 - Read/Write access available
	system_linux_nfs_mountpoint_utilization	System Linux NFS Mountpoint Utilization	%	System Linux NFS Mountpoint Utilization
	system_linux_nfs_mountpoint_availability	System Linux NFS Mountpoint Availability		System Linux NFS Mountpoint Availability - Below are the possible values: 1 - NFS Mount Point Not Available 0 - NFS Mount Point Available

Agent G2 - Linux OS File Systems Monitoring

Description

Template to monitor Linux OS advanced performance metrics related to File systems (space, Inodes utilization and change in mount status of a file system). It has been validated on following Linux flavors: RHEL 7.9, Centos 7 ,Ubuntu 20.04, Open SUSE Linux.

Prerequisites

Applicable on devices which is running Opsramp Agent ( v7.0.0 or above)

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux File Systems	system_linux_fileSystem_Inodes_Usage_Number	System Linux FileSystem Inodes Usage Number	count	File system Inodes usage number.
	system_linux_fileSystem_Inodes_Delta	System Linux FileSystem Inodes Delta	count	File system Inodes usage delta.
	system_linux_fileSystem_Space_UsedInMB	System Linux FileSystem Space Used In MB	MB	File system space usage in MB
	system_linux_fileSystem_Space_DeltaInKB	System Linux FileSystem Space Delta In KB	KB	File system space usage(KB) delta
	system_linux_fileSystem_Inodes_Utilization	System Linux FileSystem Inodes Utilization	%	File system Inodes utilization percent.
Agent G2 - Linux File Systems Mount Change Detection	system_linux_fileSystem_Mount_ChangeDetection	System Linux Filesystem Mount Change Detection		File system mount point change detection. It detects if any file system mount point removed and if any new mount point added into the system. Below are the possible values: 0 - Available, 1 - Newly Added, 2 - Removed

Agent G2 - Linux OS File Systems Monitoring - V2

Description

Template to monitor Linux OS advanced performance metrics related to File systems (Network and Local) (space, Inodes utilization and change in mount status of a file system). It has been validated on following Linux flavors: RHEL 7.9, Centos 7 ,Ubuntu 20.04, Open SUSE Linux.

Prerequisites

Applicable on devices which is running OpsRamp Agent ( v7.0.0 or above)

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux File Systems - V2	system_linux_fileSystem_Inodes_Usage_Number	System Linux FileSystem Inodes Usage Number	count	File system Inodes usage number.
	system_linux_fileSystem_Inodes_Delta	System Linux FileSystem Inodes Delta	count	File system Inodes usage delta.
	system_linux_fileSystem_Space_UsedInMB	System Linux FileSystem Space Used In MB	MB	File system space usage in MB
	system_linux_fileSystem_Space_DeltaInKB	System Linux FileSystem Space Delta In KB	KB	File system space usage(KB) delta
	system_linux_fileSystem_Inodes_Utilization	System Linux FileSystem Inodes Utilization	%	File system Inodes utilization percent.
Agent G2 - Linux File Systems Mount Change Detection - V2	system_linux_fileSystem_Mount_ChangeDetection	System Linux Filesystem Mount Change Detection		File system mount point change detection. It detects if any file system mount point removed and if any new mount point added into the system. Below are the possible values: 0 - Available, 1 - Newly Added, 2 - Removed

Agent G2 - Linux OS File Systems Monitoring - v3

Description

Prerequisites

Applicable on devices which is running OpsRamp Agent ( v7.0.0 or above)

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux File Systems - V2	system_linux_fileSystem_Inodes_Usage_Number	System Linux FileSystem Inodes Usage Number	count	File system Inodes usage number.
	system_linux_fileSystem_Inodes_Delta	System Linux FileSystem Inodes Delta	count	File system Inodes usage delta.
	system_linux_fileSystem_Space_UsedInMB	System Linux FileSystem Space Used In MB	MB	File system space usage in MB
	system_linux_fileSystem_Space_DeltaInKB	System Linux FileSystem Space Delta In KB	KB	File system space usage(KB) delta
	system_linux_fileSystem_Inodes_Utilization	System Linux FileSystem Inodes Utilization	%	File system Inodes utilization percent.
Agent G2 - Linux File Systems Mount Change Detection - V3	system_linux_fileSystem_Mount_ChangeDetection	System Linux Filesystem Mount Change Detection		File system mount point change detection. It detects if any file system mount point removed and if any new mount point added into the system. Below are the possible values: 0 - Available, 1 - Newly Added, 2 - Removed

Agent G2 - Linux OS File Systems Monitoring - v4

Description

Agent G2 - Linux OS File Systems Monitoring - v4

Prerequisites

Applicable on devices which is running OpsRamp Agent ( v7.0.0 or above)

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux File Systems - v4	system_linux_fileSystem_Inodes_Usage_Number	System Linux FileSystem Inodes Usage Number	count	File system Inodes usage number.
	system_linux_fileSystem_Inodes_Delta	System Linux FileSystem Inodes Delta	count	File system Inodes usage delta.
	system_linux_fileSystem_Space_UsedInMB	System Linux FileSystem Space Used In MB	MB	File system space usage in MB
	system_linux_fileSystem_Space_DeltaInKB	System Linux FileSystem Space Delta In KB	KB	File system space usage(KB) delta
	system_linux_fileSystem_Inodes_Utilization	System Linux FileSystem Inodes Utilization	%	File system Inodes utilization percent.
Agent G2 - Linux File Systems Mount Change Detection - v4	system_linux_fileSystem_Mount_ChangeDetection	System Linux Filesystem Mount Change Detection		File system mount point change detection. It detects if any file system mount point removed and if any new mount point added into the system. Below are the possible values: 0 - Available, 1 - Newly Added, 2 - Removed

Agent G2 - Linux OS Mount Point Monitoring

Description

Template to monitor Linux OS advanced performance metrics related to Mount Points (space,Inodes utilization and Availability status of mount point). It has been validated on following Linux flavors: RHEL 7.9, Centos 7 ,Ubuntu 20.04, Open SUSE Linux.

Prerequisites

Applicable on devices which is running Opsramp Agent ( v7.0.0 or above)

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux Mount Points	system_linux_mountpoint_Space_DeltaInKB	System Linux Mount Point Space Delta In KB	KB	Mount point space usage(KB) delta
	system_linux_mountpoint_Inodes_Usage_Number	System Linux Mount Point Inodes Usage Number	count	Mount point Inodes usage number.
	system_linux_mountpoint_Availability_Status	System Linux Mount Point Availability Status		Availability status of mount point. These are possible values: 0 - Not Available, 1 - Available
	system_linux_mountpoint_Space_UsedInMB	System Linux Mount Point Space Used In MB	MB	Mount point usage in MB
	system_linux_mountpoint_Inodes_Utilization	System Linux Mount Point Inodes Utilization	%	Mount point Inodes utilization percent.
	system_linux_mountpoint_Inodes_Delta	System Linux Mount Point Inodes Delta	count	Mount point Inodes usage delta.

Agent G2 - Linux OS Mount Point Monitoring - V2

Description

Prerequisites

Applicable on devices which is running Opsramp Agent ( v7.0.0 or above)

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Linux Mount Points - V2	system_linux_mountpoint_Space_DeltaInKB	System Linux Mount Point Space Delta In KB	KB	Mount point space usage(KB) delta
	system_linux_mountpoint_Inodes_Usage_Number	System Linux Mount Point Inodes Usage Number	count	Mount point Inodes usage number.
	system_linux_mountpoint_Availability_Status	System Linux Mount Point Availability Status		Availability status of mount point. These are possible values: 0 - Not Available, 1 - Available
	system_linux_mountpoint_Space_UsedInMB	System Linux Mount Point Space Used In MB	MB	Mount point usage in MB
	system_linux_mountpoint_Inodes_Utilization	System Linux Mount Point Inodes Utilization	%	Mount point Inodes utilization percent.
	system_linux_mountpoint_Inodes_Delta	System Linux Mount Point Inodes Delta	count	Mount point Inodes usage delta.

Agent G2 - Linux OS Performance Monitoring

Description

Agent G2 - Linux OS Performance Monitoring

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - CPU Monitor	system.cpu.usage.utilization	System CPU Utilization	%	The percentage of elapsed time that the processor spends to execute a non-Idle thread(This doesn't includes CPU steal time)
Agent G2 - Disk Monitor	system.disk.usage.freespace	System FreeDisk Usage	GB	Monitors the Free Space usage in GB
	system.disk.usage.usedspace	System Disk UsedSpace	GB	Monitors disk used space in GB
	system.disk.usage.utilization	System Disk Utilization	%	Monitors disk utilization in percentage
Agent G2 - Memory Monitor	system.memory.usage.usedspace	System Memory Used Space	GB	Physical and virtual memory usage in GB
Agent G2 - Memory Monitor	system.memory.usage.utilization	System Memory Utilization	%	Physical and virtual memory usage in percentage.
Agent G2 - Uptime Monitor	system.os.uptime	System Uptime	m	Time lapsed since last reboot in minutes
Agent G2 - Linux CPU Load Monitor	system.cpu.load	System CPU Load		Monitors the system's last 1min, 5min and 15min load. It sends per cpu core load average.
Agent G2 - Linux CPU Statistics Monitor	system.cpu.usage.stats	System CPU Usage Statistics	%	Monitors cpu time in percentage spent in various program spaces.\n\nUser - The processor time spent running user space processes \nSystem - The amount of time that the CPU spent running the kernel.\nIOWait - The time the CPU spends idle while waiting for an I/O operation to complete\nIdle - The time the processor spends idle\nSteal - The time virtual CPU has spent waiting for the hypervisor to service another virtual CPU running on a different virtual machine.\nKernal Time\nTotal Time
Agent G2 - Linux Disk Inode Utilization Monitor	system.disk.inode.utilization	System Disk Inode Utilization	%	This monitor is to collect DISK Inode metrics for all physical disks in a server.

Agent G2 - Microsoft Windows IIS App Pool State

Description

Monitors IIS App Pool States for the given app pool names by fetching the App Pool Names from Internet Information Services (IIS) Manager > Application Pools > Column ‘Name’. By default, it will monitor all the available App Pools because the default value is ‘all’ Otherwise, it will monitor the given exact app pool names separated by commas (avoid spaces for each app pool name). Status of the application pool (1 - Uninitialized, 2 - Initialized, 3 - Running, 4 - Disabling, 5 - Disabled, 6 - Shutdown Pending, 7 - Delete Pending).

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Windows IIS App Pool State	microsoft_windows_iis_appPool_state	Microsoft Windows IIS App Pool State	State	Monitors IIS App Pool States for the given app pool names by fetching the App Pool Names from Internet Information Services (IIS) Manager > Application Pools > Column 'Name'. By default, it will monitor all the available App Pools because the default value is 'all.' Otherwise, it will monitor the given exact app pool names separated by commas (avoid spaces for each app pool name). Status of the application pool (1 - Uninitialized, 2 - Initialized, 3 - Running, 4 - Disabling, 5 - Disabled, 6 - Shutdown Pending, 7 - Delete Pending).

Agent G2 - Microsoft Active Directory Domain Controller Performance and Availability

Description

Monitors Active Directory metrics like Global Catalog Bind Time, Global Catalog Search Time, DNS Servers Bind Time, Lost Object Count, SYSVol Share availability.

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Monitor Description	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft AD DNS Server Bind Time	Monitors network connectivity test to the specified DNS server IP's. Example: 127.0.0.1 127.0.0.3	microsoft_AD_DNS_server_bindTime	Microsoft AD DNS Server BindTime	ms	Monitors Microsoft Active Directory network connectivity tests to the specified DNS server IPs.
Agent G2 - Microsoft AD Global Catalog Bind Time	Monitors Active Directory Global Catalog Bind Time in Milliseconds. User need to provide AD Domain Controller IP along with its port with : separated. Example: 127.0.0.1:3268	microsoft_AD_global_catalog_bindTime	Microsoft AD Global Catalog BindTime	ms	Monitors Microsoft Active Directory Global Catalog Bind Time in milliseconds.
Agent G2 - Microsoft AD Global Catalog Search Time	Monitors Active Directory Global catalog search time in milliseconds using given Domain Controller IPS's and its associated filter. It measures the time it takes to perform the search operation. User need to provide Domain Controller IP:port and LDAP Filter Name. Example: DomainControllerIP_and_Port: 127.0.0.1:3268 AD_LDAP_Filter: organization	microsoft_AD_global_catalog_searchTime	Microsoft AD Global Catalog SearchTime	ms	Monitors Microsoft Active Directory Global Catalog Search Time in milliseconds
Agent G2 - Microsoft AD LostObjectCount_SYSVOLShareAvailability	Monitor the count of deleted Active Directory objects and availability of the Active Directory SYSVOL share.	microsoft_AD_lost_object_count	Microsoft AD Lost Object Count	count	Monitors the count of deleted Active Directory objects.
Agent G2 - Microsoft AD LostObjectCount_SYSVOLShareAvailability	Monitor the count of deleted Active Directory objects and availability of the Active Directory SYSVOL share.	microsoft_AD_SYSVOL_share_availability	Microsoft AD SYSVOL Share Availability	null	Monitors Microsoft Active Directory SYSVOL share is available or not.

Agent G2 - Microsoft Active Directory Domain Controller Performance and Availability - v2

Description

Monitors Active Directory metrics like Global Catalog Bind Time, Global Catalog Search Time, DNS Servers Bind Time, Lost Object Count, SYSVol Share availability.

Prerequisites

No Prerequisites

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft AD DNS Server Bind Time	microsoft_AD_DNS_server_bindTime	Microsoft AD DNS Server BindTime	ms	Monitors Microsoft Active Directory network connectivity tests to the specified DNS server IPs.
Agent G2 - Microsoft AD Global Catalog Bind Time	microsoft_AD_global_catalog_bindTime	Microsoft AD Global Catalog BindTime	ms	Monitors Microsoft Active Directory Global Catalog Bind Time in milliseconds
Agent G2 - Microsoft AD Global Catalog Search Time	microsoft_AD_global_catalog_searchTime	Microsoft AD Global Catalog SearchTime	ms	Monitors Microsoft Active Directory Global Catalog Search Time in milliseconds
Agent G2 - Microsoft AD LostObjectCount_SYSVOLShareAvailability	microsoft_AD_lost_object_count	Microsoft AD Lost Object Count	count	Monitors the count of deleted Active Directory objects.
Agent G2 - Microsoft AD LostObjectCount_SYSVOLShareAvailability	microsoft_AD_SYSVOL_share_availability	Microsoft AD SYSVOL Share Availability	null	Monitors Microsoft Active Directory SYSVOL share is available or not.
Agent G2 - Microsoft AD BindTime	microsoft_AD_bindTime	Microsoft AD BindTime	ms	Monitors Active Directory BindTime for Domain Controller, Infrastructure Master, Domain Naming Master, Primary Domain Controller Emulator (PDC), Relative ID master (RID), Schema Master (SCH) in milliseconds.
Agent G2 - Microsoft AD LastSuccessful Synchronization Time	microsoft_AD_lastSuccessfulSyncTime	Microsoft AD LastSuccessfulSync Time	m	Monitors Microsoft Active Directory last successful synchronization time in minutes.

Agent G2 - Microsoft Windows OS Counters - RSE - v3

Description

To Monitor OS related counters like disk, memory. In this version, added these additonal metrics support: system_windows_Memory_TotalInstalledRAM,system_windows_Memory_UsedRAM,system_windows_Memory_CommitCharge,system_windows_Memory_PageFileInstalled

Prerequisites

No Prerequisites

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
System Windows LogicalDisk Monitor	system_windows_logicaldisk_UsedSpaceInMegaBytes	System Windows LogicalDisk UsedSpace In MegaBytes	MB	Total usable space on the selected logical disk drive that was free in MB
	system_windows_logicaldisk_DiskReadPerSecond	System Windows LogicalDisk DiskRead PerSecond	rops	Disk Reads/sec is the rate of read operations on the disk.
	system_windows_logicaldisk_AvgDiskSecPerRead	System Windows LogicalDisk AvgDiskSec PerRead	null	Avg. Disk sec/Read is the average time, in seconds, of a read of data from the disk.
	system_windows_logicaldisk_AvgDiskQueueLength	System Windows LogicalDisk AvgDiskQueueLength	null	Avg. Disk Queue Length is the average number of both read and write requests that were queued for the selected disk during the sample interval.
	system_windows_logicaldisk_FreeSpaceInPercent	System Windows LogicalDisk FreeSpace In Percent	%	% Free Space is the percentage of total usable space on the selected logical disk drive that was free.
	system_windows_logicaldisk_FreeSpaceInMB	System Windows LogicalDisk FreeSpace InMB	MB	Free Megabytes displays the unallocated space, in megabytes, on the disk drive in megabytes. One megabyte is equal to 1,048,576 bytes.
	system_windows_logicaldisk_DiskWriteBytesPerSecond	System Windows Logicaldisk DiskWriteBytes PerSecond	Bps	Disk Write Bytes/sec is rate at which bytes are transferred to the disk during write operations.
	system_windows_logicaldisk_DiskWritePerSecond	System windows LogicalDisk DiskWrite PerSecond	wops	Disk Writes/sec is the rate of write operations on the disk.
	system_windows_logicaldisk_DiskReadBytesPerSecond	System Windows LogicalDisk DiskReadBytes PerSecond	Bps	Disk Read Bytes/sec is the rate at which bytes are transferred from the disk during read operations.
	system_windows_logicaldisk_AvgDiskSecPerWrite	System Windows LogicalDisk AvgDiskSec PerWrite	null	Avg. Disk sec/Write is the average time, in seconds, of a write of data to the disk.
System Windows Processor Monitor	microsoft_windows_Processor_PercentPrivilegedTime	Microsoft Windows Processor PercentPrivilegedTime	%	% Privileged Time is the percentage of elapsed time that the process threads spent executing code in privileged mode. When a Windows system service in called, the service will often run in privileged mode to gain access to system-private data. Such data is protected from access by threads executing in user mode. Calls to the system can be explicit or implicit, such as page faults or interrupts. Unlike some early operating systems, Windows uses process boundaries for subsystem protection in addition to the traditional protection of user and privileged modes. Some work done by Windows on behalf of the application might appear in other subsystem processes in addition to the privileged time in the process.
	system_windows_processorDPCrate	System Windows Processor DPCrate	null	DPC Rate is the rate at which deferred procedure calls (DPCs) were added to the processors DPC queues between the timer ticks of the processor clock. DPCs are interrupts that run at alower priority than standard interrupts. Each processor has its own DPC queue. This counter measures the rate that DPCs were added to the queue, not the number of DPCs in the queue. This counter displays the last observed value only; it is not an average.
	system_windows_processor_percentprocessortime	System Windows Processor PercentProcessorTime	%	% Processor Time is the percentage of elapsed time that the processor spends to execute a non-Idle thread. It is calculated by measuring the percentage of time that the processor spends executing the idle thread and then subtracting that value from 100%. (Each processor has an idle thread that consumes cycles when no other threads are ready to run). This counter is the primary indicator of processor activity, and displays the average percentage of busy time observed during the sample interval. It should be noted that the accounting calculation of whether the processor is idle is performed at an internal sampling interval of the system clock (10ms). On todays fast processors, % Processor Time can therefore underestimate the processor utilization as the processor may be spending a lot of time servicing threads between the system clock sampling interval. Workload based timer applications are one example of applications which are more likely to be measured inaccurately as timers are signaled just after the sample is taken.
	system_windows_processorInterruptsPerSec	System Windows ProcessorInterrupts PerSec	psec	Interrupts/sec is the average rate, in incidents per second, at which the processor received and serviced hardware interrupts. It does not include deferred procedure calls (DPCs), which are counted separately. This value is an indirect indicator of the activity of devices that generate interrupts, such as the system clock, the mouse, disk drivers, data communication lines, network interface cards, and other peripheral devices. These devices normally interrupt the processor when they have completed a task or require attention. Normal thread execution is suspended. The system clock typically interrupts the processor every 10 milliseconds, creating a background of interrupt activity. This counter displays the difference between the values observed in the last two samples, divided by the duration of the sample interval.
	microsoft_windows_ProcessorInformation_PercentC1Time	Microsoft Windows ProcessorInformation PercentC1Time	%	% C1 Time is the percentage of time the processor spends in the C1 low-power idle state. % C1 Time is a subset of the total processor idle time. C1 low-power idle state enables the processor to maintain its entire context and quickly return to the running state. Not all systems support the % C1 state
	microsoft_windows_ASP_InMemoryTemplatesCached	Microsoft Windows ASP InMemoryTemplatesCached	count	The number of compiled templates cached in memory.
System Windows PhysicalDisk Monitor	system_windows_PhysicalDisk_writesPerSec	System Windows PhysicalDisk Writes PerSec	psec	Disk Writes/sec is the rate of write operations on the disk.
	system_windows_PhysicalDisk_avgDiskSecPerRead	System Windows PhysicalDisk AvgDiskSec PerRead	null	Avg. Disk sec/Read is the average time, in seconds, of a read of data from the disk.
	system_windows_PhysicalDisk_writeBytesPerSec	System Windows PhysicalDisk WriteBytes PerSec	Bps	Disk Write Bytes/sec is rate at which bytes are transferred to the disk during write operations.
	System_Windows_PhysicalDisk_readBytesPerSec	System Windows PhysicalDisk ReadBytes PerSec	Bps	Disk Read Bytes/sec is the rate at which bytes are transferred from the disk during read operations.
	System_Windows_PhysicalDisk_avgDiskSecPerWrite	System Windows PhysicalDisk AvgDiskSec PerWrite	null	Avg. Disk sec/Write is the average time, in seconds, of a write of data to the disk.
	system_windows_PhysicalDisk_readsPerSec	System Windows PhysicalDisk ReadsPerSec	psec	Disk Reads/sec is the rate of read operations on the disk.
	System_Windows_PhysicalDisk_avgDiskQueueLength	System Windows PhysicalDisk avgDiskQueueLength	null	Avg. Disk Queue Length is the average number of both read and write requests that were queued for the selected disk during the sample interval.
	microsoft_windows_PhysicalDisk_AvgDiskBytesPerRead	Microsoft Windows PhysicalDisk AvgDiskBytesPerRead	null	Avg. Disk Bytes/Read is the average number of bytes transferred from the disk during read operations.
	microsoft_windows_PagingFile_PercentUsage	Microsoft Windows PagingFile PercentUsage	%	The amount of the Page File instance in use in percent
System Windows Server Monitor	system_windows_server_logonsPerSec	System Windows Server LogonsPerSec	psec	Logon/sec is the rate of all server logons.
	system_windows_contextSwitchesPerSec	System Windows ContextSwitchesPerSec	psec	"Context Switches/sec is the combined rate at which all processors on the computer are switched from one thread to another. Context switches occur when a running thread voluntarily relinquishes the processor, is preempted by a higher priority ready thread, or switches between user-mode and privileged (kernel) mode to use an Executive or subsystem service. It is the sum of Thread Context Switches/sec for all threads running on all processors in the computer and is measured in numbers of switches. There are context switch counters on the System and Thread objects. This counter displays the difference between the values observed in the last two samples, divided by the duration of the sample interval."
	system_windows_bytesTransmittedPerSec	System Windows BytesTransmitted PerSec	psec	The number of bytes the server has sent on the network. Indicates how busy the server is.
	microsoft_windows_System_ProcessorQueueLength	Microsoft Windows System ProcessorQueueLength	null	Processor Queue Length is the number of threads in the processor queue. Unlike the disk counters, this counter counters, this counter shows ready threads only, not threads that are running. There is a single queue for processor time even on computers with multiple processors. Therefore, if a computer has multiple processors, you need to divide this value by the number of processors servicing the workload. A sustained processor queue of less than 10 threads per processor is normally acceptable, dependent of the workload.
	system_windows_bytesReceivedPerSec	System Windows BytesReceived PerSec	psec	The number of bytes the server has received from the network. Indicates how busy the server is.
Agent G2 - Windows Memory Custom Monitor - v3	System_Windows_Pages_Output_PerSec	System_Windows_Pages_Output_PerSec	psec
	System_Windows_Memory_AvailableMbytes	System_Windows_Memory_AvailableMbytes	MB	Calculates the Memory Available in Mega Bytes of the System
	System_Windows_Memory_CommitLimit	System_Windows_Memory_CommitLimit	Bytes	Calculates the physical memory space reserved on the disk paging files
	System_Windows_Memory_CommittedBytes	System_Windows_Memory_CommittedBytes	Bytes	Calculates the Total Number of Committed Bytes of the System
	System_Windows_Memory_CommittedBytes_Inuse	System_Windows_Memory_CommittedBytes_Inuse	Bytes	Calculates the Percentage of the Committed Bytes In use of the System
	System_Windows_Memory_PageFaults_PerSec	System_Windows_Memory_PageFaults_PerSec	psec	Calculates the Total Number of Memory Page Faults Per Second of the System
	System_Windows_Memory_Pages_PerSec	System_Windows_Memory_Pages_PerSec	psec	Calculates the Total Number of Memory pages per second of the System
	system_windows_rawdata_pagesIn_PerSecond	system_windows_rawdata_pagesIn_PerSecond	null
	system_windows_Memory_TotalInstalledRAM	System Windows Memory TotalInstalledRAM	GB	Total PhysicalMemory(RAM) in GB
	system_windows_Memory_UsedRAM	System Windows Memory UsedRAM	GB	Used PhysicalMemory(RAM) in GB
	system_windows_Memory_CommitCharge	System Windows Memory CommitCharge	GB	Commit Charge is the amount of committed virtual memory. Committed memory is the physical memory which has space reserved on the disk paging file(s). There can be one or more paging files on each physical drive. This counter displays the last observed value only; it is not an average.
	system_windows_Memory_PageFileInstalled	System Windows Memory PageFileInstalled	GB	Page File Installed(Commit Limit) is the amount of virtual memory that can be committed without having to extend the paging file(s). Committed memory is the physical memory which has space reserved on the disk paging files. There can be one paging file on each logical drive). If the paging file(s) are be expanded, this limit increases accordingly. This counter displays the last observed value only; it is not an average.

Agent G2 - Microsoft Windows OS Counters - RSE - v2

Description

To Monitor OS related counters like disk,memory

Prerequisites

No Prerequisites

Agent G2 - MSSQL Database Availability Status - v2

Description

Monitors MSSQL Instance Connection Time in milliseconds and Database Instance status along with Database Status. If the Instance is in a running state and the Databases associated with the instance is offline, it considers the Instance as Down. Conversely, if the Instance is in a running state and the associated Database is up, it considers the Instance as Up. Default value is ‘all’ i.e., it will monitor all databases. If user need to monitor any particular databases, then provide the database names with comma separated. Example: master,msdb,temp.

Prerequisites

Agent G2 - MSSQL Database Availability Status - v2

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - MSSQL Database Availability Status - v2	mssql_database_availability_status	MSSQL Database Availability Status	Status	MSSQL Database Availability Status
Agent G2 - MSSQL Database Availability Status - v2	mssql_database_connection_time	MSSQL Database Connection Time	ms	Monitors MSSQL Database Instance Connection Time in milliseconds

Agent G2 - MSSQL Database Data and Log Files Freespace and Utilization

Description

Monitors MSSQL Database Log & Data file Freespace and utilization.

Prerequisites

Requires Agent version 14.0.0 or later. MSSQL database credentials must be added to the device. When assigning the template, user need to provide the MSSQL Server name (if they have multiple instances, provide it in this format: ServerName InstanceName) and MSSQL instance name (instance names will be available in services.msc) and mention that the authentication type is Windows or SQL.

Template Usage Guidelines:

Requires Agent version 14.0.0 or later.
MSSQL database credentials must be added to the device.
When assigning the template, user need to provide the MSSQL Server name (if they have multiple instances, provide it in this format: ServerName InstanceName) and MSSQL instance name (instance names will be available in services.msc) and mention that the authentication type is Windows or SQL.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - MSSQL Database Data and Log Files Freespace and Utilization	mssql_database_logFilesFreeSpace	MSSQL Database LogFileFreeSpace	%	Monitors MSSQL database LogFiles free space
	mssql_database_dataFilesFreeSpace	MSSQL Database DataFilesFreeSpace	%	Monitors MSSQL datafiles free space regardless of auto-growth
	mssql_database_ldf_file_utilization_percentage	MSSQL Database ldf File Utilization in Percentage	%	Monitors MSSQL .ldf files utilization in percentage
	mssql_database_ndf_file_utilization_percentage	MSSQL Database ndf File Utilization Percentage	%	Monitors MSSQL .ndf files utilization in percentage
	mssql_database_mdf_file_utilization_percentage	MSSQL Database mdf File Utilization Percentage	%	Monitors MSSQL .mdf files utilization in percentage

Agent G2 - MSSQL Database Agent Job Status

Description

Monitors MSSQL Agent Job Status latest information (in last 15mins only): Below are the possible status values - 0 : Failed 1 : Successful 2 : Retry 3 : Cancelled 4 : InProgress.

Prerequisites

Template Usage Guidelines:

Requires Agent version 14.0.0 or later.
MSSQL database credentials must be added to the device.
When assigning the template, user need to provide the MSSQL Server name (if they have multiple instances, provide it in this format: ServerName InstanceName) and MSSQL instance name (instance names will be available in services.msc) and mention that the authentication type is Windows or SQL.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - MSSQL Database Agent Job Status	mssql_database_agentJobStatus	MSSQL Database AgentJobStatus		MSSQL DB Agent Jobs Status : This metric collects mssql agent job status latest information (in last 15mins only): Below are the possible status values - 0 : Failed 1 : Successful 2 : Retry 3 : Cancelled 4 : InProgress

Agent G2 - Microsoft Windows MSSQL Performance and Statistics

Description:

Monitors the various performance statistics of MSSQL from versions 2000 to 2022. Ensure that required WMI classes be available in system.

Template Usage Guidelines:

While applying this template on the device, users need to provide specific input parameters specifying version of MSSQL. The default value is set to “MSSQL2022.”

Example 1: MSSQL2022

This monitors the MSSQL 2022 statistics for given metrics.

Example 2: MSSQL2019

This monitors the MSSQL 2019 statistics for given metrics.

Below are the Namespaces associated to MSSQL version.

“MSSQL2000” namespace = “root\Microsoft\SqlServer\ComputerManagement” “MSSQL2005” namespace = “root\Microsoft\SqlServer\ComputerManagement” “MSSQL2008” namespace = “root\Microsoft\SqlServer\ComputerManagement10” “MSSQL2012” namespace = “root\Microsoft\SqlServer\ComputerManagement11” “MSSQL2014” namespace = “root\Microsoft\SqlServer\ComputerManagement12” “MSSQL2016” namespace = “root\Microsoft\SqlServer\ComputerManagement13” “MSSQL2017” namespace = “root\Microsoft\SqlServer\ComputerManagement14” “MSSQL2019” namespace = “root\Microsoft\SqlServer\ComputerManagement15” “MSSQL2022” namespace = “root\Microsoft\SqlServer\ComputerManagement16”

To validate which namespaces exist on the device and provide the correct MSSQL version:

Click Start and search for computer management.
Under Services and Application, select WMI Control.
Right click services and select security tab Namespace: root\Microsoft\SqlServer?
Please find the attached screenshot for your reference.

Prerequisites

Ensure that required WMI classes be available in system.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Microsoft Windows MSSQL Performance and Statistics	microsoft_windows_MSSQL_latchWaitsPerSec	Microsoft Windows MSSQL LatchWaits PerSec	Count per sec	Monitors the number of latch requests that could not be granted immediately and had to wait before being granted.
	microsoft_windows_MSSQL_averageLatchWaitTimems	Microsoft Windows MSSQL AverageLatchWaitTimems	ms	Monitors the average latch wait time (milliseconds) for latch requests that had to wait.
	microsoft_windows_MSSQL_dataFilesSizeKB	Microsoft Windows MSSQL DataFilesSizeKB	KB	Monitors the cumulative size of all the data files in the database.
	microsoft_windows_MSSQL_logFilesUsedSizeKB	Microsoft Windows MSSQL LogFilesUsedSizeKB	KB	Monitors the cumulative used size of all the log files in the database.
	microsoft_windows_MSSQL_logFlushesPersec	Microsoft Windows MSSQL LogFlushesPersec	Count per sec	Monitors the total number of log flushes.
	microsoft_windows_MSSQL_transactionsPersec	Microsoft Windows MSSQL TransactionsPersec	Count per sec	Monitors the total number of transactions started for the database
	microsoft_windows_MSSQL_lockTimeoutsPersec	Microsoft Windows MSSQL LockTimeoutsPersec	Count per sec	Monitors the number of lock requests that timed out. This includes requests for NOWAIT locks.
	microsoft_windows_MSSQL_numberofDeadlocksPersec	Microsoft Windows MSSQL NumberofDeadlocksPersec	Count per sec	Monitors the number of lock requests that resulted in a deadlock.
	microsoft_windows_MSSQL_averageWaitTimems	Microsoft Windows MSSQL AverageWaitTimems	ms	Monitors the total average amount of wait time (milliseconds) for each lock request that resulted in a wait.
	microsoft_windows_MSSQL_lockWaitsPersec	Microsoft Windows MSSQL LockWaitsPersec	Count per sec	Monitors the total number of lock requests that could not be satisfied immediately and required the caller to wait before being granted the lock.
	microsoft_windows_MSSQL_pagelifeexpectancy	Microsoft Windows MSSQL Pagelifeexpectancy	s	Monitors the number of seconds a page will stay in the buffer pool without references
	microsoft_windows_MSSQL_lazywritesPersec	Microsoft Windows MSSQL LazywritesPersec	Count per sec	Monitors the number of buffers written by buffer manager's lazy writer.
	microsoft_windows_MSSQL_pagereadsPersec	Microsoft Windows MSSQL PagereadsPersec	Count per sec	Monitors the number of physical database page reads issued.
	microsoft_windows_MSSQL_pagewritesPersec	Microsoft Windows MSSQL PagewritesPersec	Count per sec	Monitors the number of physical database page writes issued.
	microsoft_windows_MSSQL_checkpointpagesPersec	Microsoft Windows MSSQL CheckpointpagesPersec	Count per sec	Monitors the number of pages flushed by checkpoint or other operations that require all dirty pages to be flushed.
	microsoft_windows_MSSQL_connectionMemoryKB	Microsoft Windows MSSQL ConnectionMemoryKB	KB	Monitors the total amount of dynamic memory the server is using for maintaining connections.
	microsoft_windows_MSSQL_databaseCacheMemoryKB	Microsoft Windows MSSQL DatabaseCacheMemoryKB	KB	Monitors the amount of memory the server is currently using for the database cache.
	microsoft_windows_MSSQL_freeMemoryKB	Microsoft Windows MSSQL FreeMemoryKB	KB	Monitors the amount of memory the server is currently not using.
	microsoft_windows_MSSQL_lockMemoryKB	Microsoft Windows MSSQL LockMemoryKB	KB	Monitors the total amount of dynamic memory the server is using for locks.
	microsoft_windows_MSSQL_memoryGrantsPending	Microsoft Windows MSSQL MemoryGrantsPending	count	Monitors the current number of processes waiting for a workspace memory grant.
	microsoft_windows_MSSQL_optimizerMemoryKB	Microsoft Windows MSSQL OptimizerMemoryKB	KB	Monitors the total amount of dynamic memory the server is using for query optimization.
	microsoft_windows_MSSQL_totalServerMemoryKB	Microsoft Windows MSSQL TotalServerMemoryKB	KB	Monitors the total amount of dynamic memory the server is currently consuming.
	microsoft_windows_MSSQL_SQLCacheMemoryKB	Microsoft Windows MSSQL SQLCacheMemoryKB	KB	Monitors the total amount of dynamic memory the server is using for the dynamic SQL cache.
	microsoft_windows_MSSQL_forwardedRecordsPersec	Microsoft Windows MSSQL ForwardedRecordsPersec	Count per sec	Monitors the number of records fetched through forwarded record pointers.
	microsoft_windows_MSSQL_pageSplitsPersec	Microsoft Windows MSSQL PageSplitsPersec	Count per sec	Monitors the number of page splits per second that occur as a result of overflowing index pages.
	microsoft_windows_MSSQL_fullScansPersec	Microsoft Windows MSSQL FullScansPersec	Count per sec	Monitors the number of unrestricted full scans. These can either be base table or full index scans.
	microsoft_windows_MSSQL_processesBlocked	Microsoft Windows MSSQL ProcessesBlocked	count	Monitors the Number of currently blocked processes.
	microsoft_windows_MSSQL_userConnections	Microsoft Windows MSSQL UserConnections	count	Monitors the number of users connected to the system.
	microsoft_windows_MSSQL_loginsPersec	Microsoft Windows MSSQL LoginsPersec	Count per sec	Monitors the total number of logins started per second.
	microsoft_windows_MSSQL_logoutsPersec	Microsoft Windows MSSQL LogoutsPersec	Count per sec	Monitors the total number of logouts started per second.
	microsoft_windows_MSSQL_longestTransactionRunningTime	Microsoft Windows MSSQL LongestTransactionRunningTime	s	Monitors the longest running time of any transaction in seconds.
	microsoft_windows_MSSQL_receiveIPerOsPersec	Microsoft Windows MSSQL ReceiveIPerOsPersec	Count per sec	Monitors the number of transport receives I/O per second. Note that a transport receive I/O may contain more than one message fragment
	microsoft_windows_MSSQL_sendIPerOsPersec	Microsoft Windows MSSQL SendIPerOsPersec	Count per sec	Monitors the number of transport send I/Os per second. Note that a transport send I/O may contain more than one message fragment.
	microsoft_windows_MSSQL_openConnectionCount	Microsoft Windows MSSQL OpenConnectionCount	Count	Monitors the total number of transport connections currently open.
	microsoft_windows_MSSQL_SQLCompilationsPersec	Microsoft Windows MSSQL SQLCompilationsPersec	Count per sec	Monitors the number of SQL compilations.
	microsoft_windows_MSSQL_SQLReCompilationsPersec	Microsoft Windows MSSQL SQLReCompilationsPersec	Count per sec	Monitors the number of SQL re-compiles.
	microsoft_windows_MSSQL_batchRequestsPersec	Microsoft Windows MSSQL BatchRequestsPersec	Count per sec	Monitors the number of SQL batch requests received by server.
	microsoft_windows_MSSQL_taskLimitReached	Microsoft Windows MSSQL TaskLimitReached	count	Monitors the total number of times the activated task limit on a queue has been reached.
	microsoft_windows_MSSQL_tasksAbortedPersec	Microsoft Windows MSSQL TasksAbortedPersec	Count per sec	Monitors the number of activated tasks that are being aborted per second.
	microsoft_windows_MSSQL_SQLRECEIVEsPersec	Microsoft Windows MSSQL SQLRECEIVEsPersec	Count per sec	Monitors the number of SQL RECEIVE commands processed by the Broker per second.
	microsoft_windows_MSSQL_BrokerTransactionRollbacks	Microsoft Windows MSSQL BrokerTransactionRollbacks	count	Monitors the number of Service Broker related transactions that have rolled back.
	microsoft_windows_MSSQL_SQLSENDsPersec	Microsoft Windows MSSQL SQLSENDsPersec	Count per sec	Monitors the number of SQL SEND commands processed by the Broker per second.
	microsoft_windows_MSSQL_logBytesFlushedPersec	Microsoft Windows MSSQL LogBytesFlushedPersec	Bps	Monitors the total number of log bytes flushed.
	microsoft_windows_MSSQL_percentLogUsed	Microsoft Windows MSSQL PercentLogUsed	%	Monitors the percent of space in the log that is in use.
	microsoft_windows_MSSQL_logFilesSizeKB	Microsoft Windows MSSQL LogFilesSizeKB	KB	Monitors the cumulative size of all the log files in the database.
	microsoft_windows_MSSQL_logFlushWaitsPersec	Microsoft Windows MSSQL LogFlushWaitsPersec	Count per sec	Monitors the number of commits waiting on log flush.
	microsoft_windows_MSSQL_logGrowths	Microsoft Windows MSSQL LogGrowths	count	Monitors the total number of log growths for this database.
	microsoft_windows_MSSQL_logShrinks	Microsoft Windows MSSQL LogShrinks	count	Monitors the total number of log shrinks for this database.
	microsoft_windows_MSSQL_cacheHitRatioPercentage	Microsoft Windows MSSQL CacheHitRatio Percentage	%	Monitors the percentage of cache hits relative to cache lookups.
	microsoft_windows_MSSQL_bufferCacheHitRatioPercentage	Microsoft Windows MSSQL Buffercachehitratio Percentage	%	Monitors the percentage of pages that were found in the buffer pool without having to incur a read from disk.

Agent G2 - Windows CertStore Certificates Expiry - IssuedTo_SN as component

Description

To monitor certificate(s) expiry (in days) which are available in Certificate Manager and not yet expired. This template contains “Issued To and Serial Number” in alert subject.

Template Usage Guidelines:

The script receives its parameters from custom monitor during Runtime.

Params field in the custom monitor holds the certificate store path, the excluded Thumbprints OR the keyword “all”

Formulate your Path params in the format specified below and encode the string. The string has two parts to it separated by a semicolon ( ; ).

The Certificate Store paths are separated by a comma (,) and are present to the left to the semicolon separator.

The list of Thumbprints that needs to be excluded from the monitor are comma (,) separated and are present to the right of the semicolon separator.

The error or warning alerts contains Certificate information specifying respective certificate’s Issuer, Subject, Serial Number.

Case 1: Giving input as specific paths and excluding few certificates from those paths(using their thumbprints)

Example String Before Encoding:

cert:\LocalMachine\Root, cert:\LocalMachine\AuthRoot;a8985d3a65e5e5c4b2d7d66d40c6dd2fb19c5436,df3c24f9bfd666761b268073fe06d1cc8d4f82a4

Example String After Encoding: (use a tool like notepad++ or online resource like https://www.base64encode.org/ to encode your params string)

Y2VydDpcTG9jYWxNYWNoaW5lXFJvb3QsY2VydDpcTG9jYWxNYWNoaW5lXEF1dGhSb290O+KAjmE4OTg1ZDNhNjVlNWU1YzRiMmQ3ZDY2ZDQwYzZkZDJmYjE5YzU0MzYs4oCOZGYzYzI0ZjliZmQ2NjY3NjFiMjY4MDczZmUwNmQxY2M4ZDRmODJhNA==

Case 2: Monitoring all the certificates from all folders or Current User account and Local Machine account

To monitor all the certificates user needs to give input as “all”

Prerequisite

Powershell Version 3 and above.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows CertStore Certificates Expiry - IssuedTo_SN as component	windows_certStore_certificatesExpiryInDays	Windows CertStore CertificatesExpiry InDays	Days	To monitor certificate(s) expiry (in days) which are available in Certificate Manager.

Agent G2 - Windows Memory Monitoring

Description

Agent G2 - Windows Service Monitoring v2.0

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Memory Custom Monitor	system.windows.memory.available	System Windows Memory Available	MB	Available MBytes is the amount of physical memory, in Megabytes, immediately available for allocation to a process or for system use. It is equal to the sum of memory assigned to the standby (cached), free and zero page lists.

Agent G2 - Windows Network Interface Monitoring

Description

Agent G2 - Windows Network Interface Monitoring

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Network Interface Custom Monitor	system.windows.network.interface.packets.persec	System Windows Network Interface Packets Per Sec	packets/sec	Packets/sec is the rate at which packets are sent and received on the network interface.
	system.windows.network.interface.traffic.in	System Windows Network Interface Traffic In	bps	Bytes Received/sec is the rate at which bytes are received over each network adapter, including framing characters. Network Interface\\Bytes Received/sec is a subset of Network Interface\\Bytes Total/sec.
	system.windows.network.interface.traffic.out	System Windows Network Interface Traffic Out	bps	Bytes Sent/sec is the rate at which bytes are sent over each network adapter, including framing characters. Network Interface\\Bytes Sent/sec is a subset of Network Interface\\Bytes Total/sec.
	system.windows.network.interface.traffic.total	System Windows Network Interface Traffic Total	bps	Bytes Total/sec is the rate at which bytes are sent and received over each network adapter, including framing characters. Network Interface\\Bytes Total/sec is a sum of Network Interface\\Bytes Received/sec and Network Interface\\Bytes Sent/sec.

Agent G2 - Windows Network Interface Monitoring - v3

Description

Monitors Windows Network Interface metrics. In this version of template, we have added support for new metrics, and we have also modified the metric names from the existing dotted notation to underscore format.

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Network Interface Custom Monitor - v3	system_windows_network_interface_status	System Windows Network Interface Status	null	NetConnectionStatus is a string indicating the state of the network adapter's connection to the network. The value of the property is to be interpreted as follows: 0 - Disconnected 1 - Connecting 2 - Connected 3 - Disconnecting 4 - Hardware not present 5 - Hardware disabled 6 - Hardware malfunction 7 - Media disconnected 8 - Authenticating 9 - Authentication succeeded 10 - Authentication failed 11 - Invalid Address 12 - Credentials Required Other (13?65535)
	system_windows_network_interface_currentBandwidth	System Windows Network Interface CurrentBandwidth	bps	Current Bandwidth is an estimate of the current bandwidth of the network interface in bits per second (BPS). For interfaces that do not vary in bandwidth or for those where no accurate estimation can be made, this value is the nominal bandwidth.
	system_windows_network_interface_packetsReceivedPersec	System Windows Network Interface PacketsReceivedPersec	psec	Packets Received/sec is the rate at which packets are received on the network interface.
	system_windows_network_interface_packetsSentPersec	System Windows Network Interface PacketsSentPersec	psec	Packets Sent/sec is the rate at which packets are sent on the network interface.
	system_windows_network_interface_packetsReceivedNonUnicastPersec	System Windows Network Interface PacketsReceivedNonUnicastPersec	psec	Packets Received Non-Unicast/sec is the rate at which non-unicast (subnet broadcast or subnet multicast) packets are delivered to a higher-layer protocol.
	system_windows_network_interface_packetsReceivedUnicastPersec	System Windows Network Interface PacketsReceivedUnicastPersec	psec	Packets Received Unicast/sec is the rate at which (subnet) unicast packets are delivered to a higher-layer protocol.
	system_windows_network_interface_packetsSentNonUnicastPersec	System Windows Network Interface PacketsSentNonUnicastPersec	psec	Packets Sent Non-Unicast/sec is the rate at which packets are requested to be transmitted to non-unicast (subnet broadcast or subnet multicast) addresses by higher-level protocols. The rate includes the packets that were discarded or not sent.
	system_windows_network_interface_packetsSentUnicastPersec	System Windows Network Interface PacketsSentUnicastPersec	psec	Packets Sent Unicast/sec is the rate at which packets are requested to be transmitted to subnet-unicast addresses by higher-level protocols. The rate includes the packets that were discarded or not sent.
	system_windows_network_interface_offloadedConnections	System Windows Network Interface OffloadedConnections	count	Offloaded Connections is the number of TCP connections (over both IPv4 and IPv6) that are currently handled by the TCP chimney offload capable network adapter.
	system_windows_network_interface_packetsOutboundErrors	System Windows Network Interface PacketsOutboundErrors	count	Packets Outbound Errors is the number of outbound packets that could not be transmitted because of errors.
	system_windows_network_interface_packetsReceivedErrors	System Windows Network Interface PacketsReceivedErrors	count	Packets Received Errors is the number of inbound packets that contained errors preventing them from being deliverable to a higher-layer protocol.
	system_windows_network_interface_outputQueueLength	System Windows Network Interface OutputQueueLength	count	Output Queue Length is the length of the output packet queue (in packets). If this is longer than two, there are delays and the bottleneck should be found and eliminated, if possible. Since the requests are queued by the Network Driver Interface Specification (NDIS) in this implementation, this will always be 0.
	system_windows_network_interface_packetsReceivedDiscarded	System Windows Network Interface PacketsReceivedDiscarded	count	Packets Received Discarded is the number of inbound packets that were chosen to be discarded even though no errors had been detected to prevent their delivery to a higher-layer protocol. One possible reason for discarding packets could be to free up buffer space.
	system_windows_network_interface_packetsOutboundDiscarded	System Windows Network Interface PacketsOutboundDiscarded	count	Packets Outbound Discarded is the number of outbound packets that were chosen to be discarded even though no errors had been detected to prevent transmission. One possible reason for discarding packets could be to free up buffer space.
	system_windows_network_interface_utilization	System Windows Network Interface Utilization	%	Network Interface utilization in percentage.
	system_windows_network_interface_trafficIn	System Windows Network Interface TrafficIn	bps	Bytes Received/sec is the rate at which bytes are received over each network adapter, including framing characters. Network Interface\Bytes Received/sec is a subset of Network Interface\Bytes Total/sec.
	system_windows_network_interface_trafficOut	System Windows Network Interface TrafficOut	bps	Bytes Sent/sec is the rate at which bytes are sent over each network adapter, including framing characters. Network Interface\Bytes Sent/sec is a subset of Network Interface\Bytes Total/sec.
	system_windows_network_interface_trafficTotal	System Windows Network Interface TrafficTotal	bps	Bytes Total/sec is the rate at which bytes are sent and received over each network adapter, including framing characters. Network Interface\Bytes Total/sec is a sum of Network Interface\Bytes Received/sec and Network Interface\Bytes Sent/sec.
	system_windows_network_interface_packetsPersec	System Windows Network Interface PacketsPersec	packets/sec	Packets/sec is the rate at which packets are sent and received on the network interface.

Agent G2 - Windows Network Interface Monitoring - v2

Description

Agent G2 - Windows Network Interface Monitoring - v2

Prerequisites

NULL

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Network Interface Monitoring - v2	system.windows.network.interface.packets.received.persec	System Windows Network Interface Packets Received Per Sec	packets/sec	PacketsReceived/sec is the rate at which packets are received on the network interface.
system.windows.network.interface.packets.sent.persec	System Windows Network Interface Packets Sent Per Sec	packets/sec	PacketsSentPerSec is the rate at which packets are sent on the network interface.
system.windows.network.interface.traffic.out	System Windows Network Interface Traffic Out	bps	Bytes Sent/sec is the rate at which bytes are sent over each network adapter, including framing characters. Network Interface\\Bytes Sent/sec is a subset of Network Interface\\Bytes Total/sec.
system.windows.network.interface.packets.persec	System Windows Network Interface Packets Per Sec	packets/sec	Packets/sec is the rate at which packets are sent and received on the network interface.
system.windows.network.interface.traffic.in	System Windows Network Interface Traffic In	bps	Bytes Received/sec is the rate at which bytes are received over each network adapter, including framing characters. Network Interface\\Bytes Received/sec is a subset of Network Interface\\Bytes Total/sec.
system.windows.network.interface.traffic.total	System Windows Network Interface Traffic Total	bps	Bytes Total/sec is the rate at which bytes are sent and received over each network adapter, including framing characters. Network Interface\\Bytes Total/sec is a sum of Network Interface\\Bytes Received/sec and Network Interface\\Bytes Sent/sec.

Agent G2 - Windows Registry Monitoring

Description

Agent G2 - Windows Registry Monitoring

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Registry Custom Monitor	system.windows.registry.quota.usage	System Windows Registry Quota Usage	%	% Registry Quota In Use is the percentage of the Total Registry Quota Allowed that is currently being used by the system. This counter displays the current percentage value only; it is not an average.

Agent G2 - Windows Services Monitoring

Description

Agent G2 - Windows Services Monitoring

Prerequisites

Provide ServiceNames with comma separated as input parameters while applying the template at device level.
Example: opsramp-agent,opsramp-shield,power.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Services Custom Monitor	system.windows.service.status	System Windows Service Status	NULL	It gives the current status of the given service name(s), In graph 1 - Running & 0 - Stopped

Agent G2 - Windows Service Monitoring v2.0

Description

It monitors the windows service monitoring with Regex support.

Prerequisites

Provide service names as input arguments separated by commas when applying the template at the device level, along with support for regular expressions.

Syntax: serviceName1,serviceName2,regexPattern1,regexPattern2.

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Services Custom Monitor v2.0	System_Windows_Service_Status_Ext	System Windows Service Status Ext	NULL	It gives the current status of the services by matching with the given service name(s) or regex patterns(s). Below are the possible values: Stopped - 0, Running - 1, Start Pending - 2, Stop Pending - 3, Continue Pending - 4, Pause Pending - 5, Paused - 6, Unknown - 7

Agent G2 - Windows Service Monitoring - v3

Description

To monitor the windows services status

Template Usage Guidelines:

When assigning this template on the device, users need to pass specific input parameters. These parameters should be provided as one or more service names (not the service display names) or service name regex patterns.
To provide multiple service names or service name regex patterns, seperate them with commas.
SAMPLE CUSTOM SCRIPT ARGUMENTS:
Example 1(With regex): ^opsramp,agent$,Power
Example 2(Without Regex): Netlogon,Dnscache,RpcEptMapper

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Services Custom Monitor - v3	System_Windows_Service_Status_Ext	System Windows Service Status Ext		It gives the current status of the services by matching with the given service name(s) or regex patterns(s). Below are the possible values: Stopped - 0, Running - 1, Start Pending - 2, Stop Pending - 3, Continue Pending - 4, Pause Pending - 5, Paused - 6, Unknown - 7

Agent G2 - Windows Mountpoint Monitoring

Description

Agent G2 - Windows Mountpoint Monitoring

Prerequisites

No prerequisite

Supported Metric

Monitor Name	Metric Name	Metric Display Name	Unit	Description
Agent G2 - Windows Mountpoint Custom Monitor	system.windows.mountpoint.disk.freespace	System Windows MountPoint Disk FreeSpace	MB	Shows the free space of mounted disks in MB.
Agent G2 - Windows Mountpoint Custom Monitor	system.windows.mountpoint.disk.usage	System Windows MountPoint Disk Usage	%	Shows the utilization space of mounted disks in percentage.